KEGG   Faecalibaculum rodentium: AALO17_09530Help
Entry
AALO17_09530      CDS       T04268                                 

Definition
(GenBank) tRNA (uracil-5-)-methyltransferase
  KO
K04094  methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase [EC:2.1.1.74]
Organism
fro  Faecalibaculum rodentium
Brite
KEGG Orthology (KO) [BR:fro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:fro03016]
    AALO17_09530
   03036 Chromosome and associated proteins [BR:fro03036]
    AALO17_09530
Enzymes [BR:fro01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.74  methylenetetrahydrofolate---tRNA-(uracil54-C5)-methyltransferase (FADH2-oxidizing)
     AALO17_09530
Transfer RNA biogenesis [BR:fro03016]
 Prokaryotic type
  tRNA modification factors
   Methyltransferases
    AALO17_09530
Chromosome and associated proteins [BR:fro03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    AALO17_09530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GIDA Pyr_redox_2 AlaDh_PNT_C NAD_binding_8 3HCDH_N DAO FAD_binding_3 Pyr_redox FAD_binding_2 HI0933_like Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AMK54087
UniProt: A0A140DTW0
Position
877371..878717
Genome map
AA seq 448 aa AA seqDB search
MSKVTVIGAGLAGSEAAWQLVSRGIPVRIIEMRPEKKPEAFHTDGFAELVCSNSLRSDSL
NNAVGILKEEMRQLDSLIMKAADENRVPAGSALAVDRAGFSEEVTKTLKEHPLVEVITEE
VTEIPDGPVIIATGPLTSEKLAADIMKKTGSETFHFYDAAAPIVEKDSIDFSRAYYKSRY
DKGDADYINCPMEQEEFDAFYEELIHAKCADLHDFEKDLKVFEGCMPIEEMARRGKKTML
FGPMKPVGLRREGEHPVAVIQLRQDDVADTLYNIVGFQTHLTWPEQKRVFSMIPGLENAR
FVRYGVMHRNSYLPAKDVLLETYQSRLRPDLFFAGQLTGVEGYVESAASGLAAGINMARV
LQGREPVKFGRQTALGAQAHYIANCEAKNLQPMNANFGIMVLEEPCHKRERKAAFARQSA
RRIREIREMLQAEDGEPERGVRKSAERE
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaagtcacggtcatcggcgcaggcctggcagggtcggaagccgcctggcagctg
gtcagccggggaatcccggtgaggatcattgagatgcgtccggaaaagaaaccggaggct
ttccatacggacggcttcgccgaactggtctgctcgaactctctgcgctcggattccctg
aacaacgctgtggggatcctcaaggaggagatgcggcagctggattccctgatcatgaaa
gccgcggatgaaaaccgggttccggccgggagtgccctggctgttgaccgtgcgggtttc
tcggaggaggtcacgaagacgctgaaggaacacccgctggtggaagtgatcacagaagaa
gtcacggaaatacccgacggaccggtgatcattgccacgggcccgctgacatcggagaag
ctggctgcagacatcatgaagaaaaccggttcggagacatttcatttctatgatgccgcg
gcaccgatcgtggaaaaggacagcatcgatttttcccgggcatactacaagtcccggtat
gacaaaggagatgcggactatatcaactgtcccatggaacaagaggaatttgacgctttt
tacgaggagctcattcacgcaaagtgtgccgatcttcatgacttcgagaaggacctgaag
gtgttcgaaggctgtatgcccatcgaggagatggcccggcgtggcaagaaaacaatgctc
ttcgggccgatgaaacccgtcgggctgcggcgggaaggggaacatcccgtggcggtgatc
cagctgcggcaggatgatgtggcggatactctgtacaacattgtgggcttccagacgcat
ctgacctggcctgagcagaagcgggtgttctccatgatcccgggtctggaaaacgccagg
tttgtccgctatggcgtgatgcaccggaacagctatctgccggcaaaggatgttctgctg
gagacctatcagtccagactgcgtccggatctgttttttgcagggcagctgacaggagtc
gaaggatatgtggagagtgcagccagcgggctggcggcaggcatcaacatggcccgggtc
ctgcagggcagggaaccggtgaagtttggccggcagaccgcactgggagcccaggctcac
tacattgcaaactgtgaggcaaagaatctgcagcccatgaatgcaaatttcggcatcatg
gtgctggaggaaccctgtcacaagagagagcggaaagcggcttttgccagacagtctgcc
agacggatccgggaaatccgggaaatgctccaggcagaggatggtgaaccggagcggggg
gtccggaagtccgctgaacgggagtga

DBGET integrated database retrieval system