KEGG   Frondihabitans sp. PAMC 28766: AX769_02315Help
Entry
AX769_02315       CDS       T04281                                 

Definition
(GenBank) hypothetical protein
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
frp  Frondihabitans sp. PAMC 28766
Pathway
frp00520  Amino sugar and nucleotide sugar metabolism
frp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:frp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AX769_02315
Enzymes [BR:frp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     AX769_02315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind 3Beta_HSD NAD_binding_4 NAD_binding_10 Polysacc_synt_2 KR adh_short
Motif
Other DBs
NCBI-ProteinID: AMM19176
UniProt: A0A126YWV6
Position
complement(489602..490558)
Genome map
AA seq 318 aa AA seqDB search
MNNPYSSFAGSRVIITGSAGFIGSALVDWLLEAGAHVIGIDIRQGCDKVGYEHLMGDASR
LSVDDLRRLRPDYLFHLASIVGVVEASSDPAATRHAILGMTEQFVEMVAEVEGVRFVYVS
SSEVYGQADDFPIVETTPLSPLSAYGQAKRDAETVVLRACADDRLDGVVVRPFNVYGPGQ
RADFVTSRFIELALGDDDLTLVGGGDQVRTFTYIDDFVDGLLRAAVHTGSQRVFNVAGPE
TASIAELASIIVDESGSRASVVSVETETLGRPSDIEVRDRIASCDAARRELAYAPSIGIR
EGVSRMISHRRRGELVTR
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacccctattcctccttcgccggctctcgagtcatcatcaccggctcggccggc
ttcatcggctcggcactcgtcgactggctgctcgaggcaggtgcccatgtcatcggcatc
gacatccgccagggctgcgacaaggtcggctacgaacatctcatgggcgacgcgtctcga
ctctcggtcgacgacctccgacgactccgacccgactacctcttccacctggcctcgatc
gtcggcgtcgtggaggcgtcgagtgatccggccgcgacccggcatgccatcctcggcatg
acagaacagttcgtcgagatggtcgccgaggtcgagggcgtccgtttcgtctacgtgtcg
tcatccgaggtctacgggcaggccgacgactttccgatcgtcgagacgacccctctctcg
ccgttgagcgcctacggccaggcgaagcgggacgccgagacggtcgtcctccgggcttgc
gccgacgatcgcctcgatggtgtggtcgttcgcccgttcaacgtctacggccccggccag
cgcgccgacttcgtcacctcgcgtttcatcgagctcgctctcggtgatgacgacctcacg
ctcgtcggagggggtgaccaggtgcggaccttcacctacatcgacgatttcgtcgacggg
ctcctgcgagcagccgtccacacgggcagccagcgcgtgttcaacgtcgctggccccgag
accgccagcatcgccgaactcgcctcgatcatcgtggacgagtcgggcagtcgcgcgtcc
gtcgtcagcgtcgaaaccgagacactcggccggccgagcgacatcgaagtgcgcgaccgc
atcgccagctgcgacgccgcgcgccgcgagctcgcctacgcgccctcgatcggaattcgc
gaaggcgtctcgcggatgatcagtcaccgccggcgcggcgagctcgtcacgcgctag

DBGET integrated database retrieval system