KEGG   Frondihabitans sp. PAMC 28766: AX769_08035Help
Entry
AX769_08035       CDS       T04281                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
frp  Frondihabitans sp. PAMC 28766
Pathway
frp00450  Selenocompound metabolism
frp00970  Aminoacyl-tRNA biosynthesis
frp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:frp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AX769_08035
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AX769_08035
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:frp01007]
    AX769_08035
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:frp03016]
    AX769_08035
Enzymes [BR:frp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AX769_08035
Amino acid related enzymes [BR:frp01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AX769_08035
Transfer RNA biogenesis [BR:frp03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AX769_08035
 Prokaryotic type
   Other AARSs
    AX769_08035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AMM20125
UniProt: A0A126Z0Y4
Position
1642808..1644379
Genome map
AA seq 523 aa AA seqDB search
MPVGDSFYITTPIFYVNDVPHIGHAYTEVAADVLARWHRQRGDDTWLLTGTDEHGQKIQR
TAVSHDVTPKAWADKLVEEAWKPLLEAIDITNDDFIRTTDERHERGVQLFLQKLYDDGFI
YQGEFEGYYCVGCEEYKQQSDLVEGTGPYEGELVCAIHSKPVELLKESNYFFRMSDFEKP
LLDLYESQASFIQPESVRNEIVSFVKQGLRDLSISRASFDWGIKVPWDDSHVVYVWFDAL
LNYVTAVGYGVDDEEFGRRWPAMHLVGKDIARFHAVIWPAMLMAAGLPVPKNVFGHGWLL
VGGEKMSKSKLTGIAPQQITDTFGVDAFRYYFMRAITFGQDGNFSWEDISARYQAELANG
FGNLASRIIAMITRYFDGTVPVAGDLTEQDLVIRQTELRVTEGADEAIGRYAINEAVSTI
WELVDALNGYITEQEPWKLAKDEASRERLGTVLATALRGLGTLTVLLSPFIPGAAHRLWE
SIGQGELTSQNIDHAAEWSSAPSVKPLESTLFPRIEQPEPATA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtcggcgactccttctacatcaccacgcccatcttctacgtcaacgatgtgccc
cacatcggtcacgcctacaccgaggtggcggccgacgtgctcgcccgctggcaccgccag
cgcggcgacgacacctggctgctgaccggcaccgacgagcacggccagaagatccagcgc
accgccgtcagccacgacgtcacgccgaaggcctgggccgacaagctcgtcgaggaggcc
tggaagccgctgctcgaggccatcgacatcaccaacgacgacttcatccgcaccaccgac
gagcgccacgagcgcggcgtgcagctgttcctccagaagctgtacgacgacggcttcatc
taccagggcgagttcgagggctactactgcgtcggctgtgaagagtacaagcagcagtcc
gacctcgtcgagggcaccgggccctacgagggcgagctggtctgcgcgatccactcgaag
cccgtcgagctgctcaaagagagcaactacttcttccggatgagcgacttcgaaaagccg
ctgctcgacctctacgagtcgcaagcgtccttcatccagcccgagagcgtccgcaacgag
atcgtgtcgttcgtcaagcagggtctccgcgacctctcgatctcgcgcgcctcgttcgac
tggggcatcaaggtgccgtgggacgactcgcacgtcgtctacgtctggttcgacgcgttg
ctcaactacgtcacggccgtcggctacggcgtcgacgacgaggagttcggccgccgctgg
ccggccatgcacctcgtcggtaaagacattgcgcggttccacgccgtcatctggccggcc
atgctcatggctgccggcctgcccgtgccgaagaacgtcttcggtcacggctggctgctc
gtcgggggcgagaagatgtcgaagtcgaagctgaccggcatcgcgccgcagcagatcacc
gacacgttcggcgtcgacgccttccgctattacttcatgcgcgccatcaccttcggccag
gacggcaacttctcgtgggaggacatttctgcgcgctaccaggccgagctcgccaacggc
ttcggcaacctggcgtcgcgcatcatcgcgatgatcacgcgctacttcgacggcaccgtg
cccgttgcgggcgacctcaccgagcaggacctcgtgatccgccagaccgagctgcgggtg
accgaaggcgccgacgaggcgatcggccgctacgcgatcaacgaggcggtgagcaccatc
tgggagctcgtcgacgccctgaacggctacatcaccgagcaggagccgtggaagctcgcc
aaagacgaggcctctcgcgagcgcctcggcacggtgctggccacggcgctgcgcggcttg
ggcacgctgacggtgctgctcagcccgttcatcccgggcgccgcacaccgcctgtgggag
agcatcgggcagggcgagctgaccagccagaacatcgaccacgcggccgagtggtcgtcg
gcgcccagcgtgaagccgctggagtcgacgctcttcccgcgcatcgagcagccggagccg
gccaccgcgtga

DBGET integrated database retrieval system