KEGG   Frondihabitans sp. PAMC 28766: AX769_10625Help
Entry
AX769_10625       CDS       T04281                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
frp  Frondihabitans sp. PAMC 28766
Brite
KEGG Orthology (KO) [BR:frp00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    AX769_10625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AMM22349
UniProt: A0A126Z5C1
Position
2196069..2197238
Genome map
AA seq 389 aa AA seqDB search
MATPIATGAMRPRVAVTVAACLNLVGAFLSTEVAKTISGGIIREGPGGVDITPTMIFAGL
VGAVIWNMITWLRGLPSSSSHALFGGLIGAAVVGAGLDSVDFGVVLSKVVLPAVLAPLVA
GLVAFTCTRLAYFITRRPNAKNQRGGFRVGQIFTSSMVALAHGTNDAQKTMGVITLTLIA
GGFLSSNASPPIWVIIVCAFAIAMGTYTGGWRIIQTLGGGLTDVKATQGFSAEASTAATV
LASSHLGFALSTTQVSSGSIIGAGLGRRGSKIQWGTAGKIVIAWFITLPASGAVGAVCEL
IARLGVIGLVIDALLGAAVIVGIFVASRRKPAEQSNALEVDVAMNSVLTRRERRALLKKR
SDEMLEARRRLSDESSLFELGAEVDGAPR
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggcgacaccgatcgccaccggtgcgatgaggccacgggtcgcggtgacggtggccgcg
tgcctcaacctcgtcggcgcgttcctctcgaccgaggtcgcgaagacgatctcgggcggc
atcatccgcgagggcccgggcggcgtcgacatcacgccgaccatgatcttcgccgggctc
gtcggcgccgtgatctggaacatgatcacctggctgcgcggcctgccgtcgtcgtcgtcc
catgctctcttcggcggtctcatcggcgccgccgtcgtcggcgccggcctcgactcggtc
gacttcggcgtcgtcctgtcgaaggtcgtgctgccggccgttctcgcaccgctcgtcgcc
ggcctcgtcgccttcacgtgcacgcggctcgcctacttcatcacccgccgccccaacgcg
aagaaccagcgcggcggattccgcgtcgggcagatcttcacctcgtcgatggtggcgctc
gcgcacggcaccaacgacgcgcagaagaccatgggcgtgatcacgctgaccttgatcgcg
ggcgggttcctgtcgtcgaacgcgtcgccgcccatctgggtgatcatcgtctgcgccttc
gccatcgcgatgggcacgtacaccggcggctggcgcatcatccagacgctcggcggcggt
ctcaccgacgtgaaggcgacacagggcttctcggccgaggcgtcgaccgccgcgacggtc
ctcgcctccagccacctcggcttcgcgctctcgacgactcaggtgtcgtcgggctcgatc
atcggcgcggggctcggccgccgcgggtcgaagatccagtggggcaccgccggcaagatc
gtcatcgcctggttcatcacccttcccgcctcgggtgccgtcggcgccgtctgcgagctg
atcgcgcgcctcggcgtgatcggcctcgtcatcgacgccctgctcggcgccgccgtcatc
gtgggcatcttcgtcgcatcgcggcgcaagcccgccgagcagtcgaacgccctggaggtc
gacgtcgccatgaactccgtgctcacccgcagagagcgccgcgccctgctcaagaagcgc
agcgacgagatgctcgaggcgcgccgccgcctgagcgacgagtcgtcgctcttcgagctc
ggcgccgaggtcgacggggctccgcgatga

DBGET integrated database retrieval system