KEGG   Francisella sp. TX077308: F7308_0020Help
Entry
F7308_0020        CDS       T01560                                 

Definition
(GenBank) Aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
frt  Francisella sp. TX077308
Pathway
frt00240  Pyrimidine metabolism
frt00250  Alanine, aspartate and glutamate metabolism
frt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:frt00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    F7308_0020
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    F7308_0020
Enzymes [BR:frt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     F7308_0020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace HSBP1
Motif
Other DBs
NCBI-ProteinID: AEI34948
UniProt: F8G721
Position
complement(20836..21762)
Genome map
AA seq 308 aa AA seqDB search
MLSFQKLLRGDQITKDDLYKLFHQADIYKNKLANSEPIKDLEGKILASLFFEPSTRTRFS
FESAMNRLGGKVISLENGASSSTQKGETLDDTGRMMDQYADIIVMRHPKPHSVEEFSKYV
HSPVINAGDGENEHPTQSLVDLYTIYSEKGSLDNLKIGFLGDLKYGRTVHSLTNILAKYN
ATFKFISSKELQIPEKLRDFVEKNGNSFSELEEVSAEALKDLDVLYVTRVQRERFPNEES
YLENKDLCYLDRKHISATSNFIILHPLPRVDEMDRSIDELECAKYFDQIKYSVPIRMSLL
SLLLKSQN
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgctatcatttcaaaagcttctacgaggcgatcaaattactaaagatgacttatataaa
ctatttcatcaagctgatatttataaaaataaactagctaattcagaacccatcaaagat
ttagaaggcaaaatactagcatctcttttctttgaaccaagtactagaacaaggttctct
tttgaatctgctatgaatagacttggtggtaaggttatatcactagaaaacggtgcttct
agctctacccaaaaaggcgaaacccttgatgacacaggtagaatgatggatcaatatgct
gacatcatagttatgcgtcatcctaagcctcacagtgttgaagaattctcaaaatatgtt
cactcacctgtgataaatgctggcgatggtgaaaatgagcaccctacccagtcattagtt
gatttatatactatctattctgagaaaggctctcttgataacctaaaaattggtttctta
ggagatctgaaatatggtcgtacagttcattcattaactaatatcttagctaaatataat
gctacatttaaatttatatcttcaaaagaactgcaaatccctgagaaacttagagatttt
gttgagaaaaatggtaattcttttagtgaactagaagaggtaagcgctgaagctctgaaa
gatttagatgtactatatgtaactcgtgttcaaagagagagatttccaaatgaagagagt
tatttagagaataaagatttatgctacttagatagaaaacatatttccgctactagcaac
ttcataatccttcatcctctaccaagagttgatgagatggatagatctatagatgagctt
gagtgtgcaaaatattttgatcaaatcaaatatagtgttcctattagaatgtctctgcta
tcattacttctaaaatcacaaaactaa

DBGET integrated database retrieval system