KEGG   Francisella sp. TX077308: F7308_0210Help
Entry
F7308_0210        CDS       T01560                                 

Definition
(GenBank) Oxygen-insensitive NAD(P)H nitroreductase / Dihydropteridine reductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
frt  Francisella sp. TX077308
Pathway
frt00633  Nitrotoluene degradation
frt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:frt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    F7308_0210
Enzymes [BR:frt01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     F7308_0210
  1.-  
   1.-.-  
    1.-.-.-  
     F7308_0210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: AEI35138
UniProt: F8G8A3
Position
complement(217701..218354)
Genome map
AA seq 217 aa AA seqDB search
MNIVEYAKTRYTTKAYDPTKKLNSEQVQQIKDLLRFTPSSVNSQPWHFILATSDKAKAKI
SKAAENIHPKNVTNIKDCALAIVFCLKTDIDDKYLQLLLDQERKDGRFPTSDFENMQRDV
RKKFALAYKDKPQELQIWTEKQLYIALGNILLGLSALKIDATPMEGIEANIIDEEFNLRE
KGYKTSVVVTVGYASEEDFNAKLPKSRLPEDKIFTEI
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcgtcgaatatgccaaaactcgctacactacaaaagcttatgatccaacaaaa
aagttaaactctgaacaagtccaacaaataaaagacttgctaagattcacaccgtcaagt
gtaaactcacagccatggcattttatcctagcaacatctgataaggcaaaagccaaaatt
tcaaaagctgctgaaaatatacacccaaaaaatgtaacaaatattaaagactgtgctttg
gctatagtattttgcctaaaaactgatatcgatgacaaatatctacagctacttcttgat
caagagcgtaaagatggtagatttcctacttcagattttgaaaatatgcaaagagatgta
cgcaaaaaatttgctctagcatacaaagacaaaccacaagaattacagatttggacagaa
aagcagctttatattgcccttggtaatattctattaggattatccgcactgaaaatagat
gctacgccaatggaaggtatcgaagctaatataatagacgaagaatttaatctaagagaa
aaaggttataaaacatccgtggttgtaactgttggttatgcttcagaagaagattttaat
gctaaattaccaaaatctagactacctgaagataaaatatttacagaaatttag

DBGET integrated database retrieval system