KEGG   Francisella sp. TX077308: F7308_0344Help
Entry
F7308_0344        CDS       T01560                                 

Definition
(GenBank) 3-demethylubiquinone-9 3-methyltransferase
  KO
K00568  2-polyprenyl-6-hydroxyphenyl methylase / 3-demethylubiquinone-9 3-methyltransferase [EC:2.1.1.222 2.1.1.64]
Organism
frt  Francisella sp. TX077308
Pathway
frt00130  Ubiquinone and other terpenoid-quinone biosynthesis
frt01100  Metabolic pathways
frt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:frt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    F7308_0344
Enzymes [BR:frt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.64  3-demethylubiquinol 3-O-methyltransferase
     F7308_0344
    2.1.1.222  2-polyprenyl-6-hydroxyphenol methylase
     F7308_0344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_11 Methyltransf_31 Methyltransf_25 Methyltransf_12 PrmA NodS MTS Ubie_methyltran CMAS DREV Methyltransf_32 Methyltransf_9 TPMT Methyltransf_18 MetW GidB RrnaAD TehB Methyltransf_15 MethyltransfD12
Motif
Other DBs
NCBI-ProteinID: AEI35272
UniProt: F8G8W7
Position
complement(340300..341118)
Genome map
AA seq 272 aa AA seqDB search
MAKIYRAYYSKLTPKTLIKIFLDIISLVLFKKYIHNKRILTMSNIDSNEVDKFSRLASDW
WNPKGELKTLHQVNPLRLEFIKKFTNLSNEKIIDVGCGGGILTESLKNQTNNVCGLDASS
QAINVAKEHAKLNNLEIEYISSTIEDFITNNDTQFDVITCMEMLEHVPDPESIIASISKL
IKKDGLFFASTLNRNIKSYLLSIVAAEHILKMVPQGTHQYAKFIKPYELIKTAENYGFSA
LEIIGVHYNPITDSFKLGKGTDVNYIVAFKKV
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
ttggcaaaaatatacagagcctattatagtaaattaactccaaaaactctaataaaaatt
ttcttagatattatatctttggtattatttaaaaaatatatacataataaaagaatatta
actatgagtaatattgatagtaatgaagttgataaattttctcgtttagctagtgattgg
tggaatccaaaaggtgaactaaaaactctacaccaggtgaatcccctaagattagagttt
ataaaaaaatttactaatctgagtaatgaaaaaataattgatgttggttgtggcggagga
attctaactgaatctttgaagaatcagacaaataatgtttgtggattagatgcttcctca
caagctattaatgtggctaaagagcatgcaaaactaaataatcttgaaatagaatatata
agttccactattgaagattttattaccaataatgatactcaatttgatgttataacttgt
atggaaatgttagaacatgtcccagatcctgaaagcattattgcctctatttcaaagctt
atcaaaaaagatggactattttttgcatcaacactaaatagaaatattaagtcttatcta
ttatctatagttgctgctgaacacatcttaaaaatggtacctcagggaacacaccaatac
gctaaatttattaaaccttatgagcttataaaaacagctgaaaattatggttttagtgct
ctggaaataatcggcgtacactacaatcctataactgacagttttaaacttggtaaaggt
actgatgttaattatattgtcgcattcaaaaaggtataa

DBGET integrated database retrieval system