KEGG   Francisella sp. TX077308: F7308_0478Help
Entry
F7308_0478        CDS       T01560                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
frt  Francisella sp. TX077308
Pathway
frt00450  Selenocompound metabolism
frt00970  Aminoacyl-tRNA biosynthesis
frt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:frt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    F7308_0478
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    F7308_0478
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:frt01007]
    F7308_0478
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:frt03016]
    F7308_0478
Enzymes [BR:frt01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     F7308_0478
Amino acid related enzymes [BR:frt01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   F7308_0478
Transfer RNA biogenesis [BR:frt03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    F7308_0478
 Prokaryotic type
   Other AARSs
    F7308_0478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AEI35406
UniProt: F8G9R1
Position
complement(454838..456871)
Genome map
AA seq 677 aa AA seqDB search
MRKILVTNALPYANGDLHLGHMLGYIQSDIWVRFQKLQGNECIFVCGSDTHGTPIMLKAK
SLGITPEELVEKYSNNHQKDFLSFEIEFDNYHSTHSQINKEIVEDIYGKLNAQKLISKKE
IAQAYDPEAKMFLPDRFVKGTCPKCKAEDQYGDSCEVCGATYDPTELINPKSVVSGKAPI
QKNSEHFFFDLPALEKDIKNWIESNKSLQPEVANKLAEWFEQGLQSWDISRDAPYFGYPI
PGTNEQKFFYVWLDAPMGYIASFKDYCNKSNVDFNEFLGDNSCESELYHFIGKDIIYFHA
LFWPAILSSTGYKTPTSVFANGFLTVNGKKMSKSRGTFIQARTYLDNLEPSYLRYYFASR
LTSRIDDIDLNLEEFVTKSNSDIVGKVVNIASRCAGFIYKKFDATLANEVFDKELEEEFA
KNHHAITEAFEKREFAHAVRLIMALADKANQFIDHHKPWQLAKEEDQEQKVHQVCSQGIN
MFKVLVSYLKPIIPSIVAKAEAFLNIEIANWNDTPTFLKNHKINKFKPLARRIEKEKVDK
ILEDTKKMLEKEQSQKQTEPKKEGSKLDIAEECTFDDFMKVDLRVARIAEASHVEGADKL
LRLILDLGGVTKQVFAGIKSAYKPEDLVGKHTVMVANLAPRKMKFGISEGMVLAAGDGKG
IYILEPHEGAQPGMRVK
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaattctagttactaatgcactgccatatgcaaatggcgatcttcatttaggc
catatgcttgggtatatacagtcagacatttgggttagatttcaaaaactacaaggtaat
gaatgtatatttgtctgtggcagcgatacacacggcactccaataatgcttaaagctaaa
agcttaggtatcacaccagaagaacttgttgaaaaatactcaaacaatcaccaaaaagat
tttttaagcttcgaaattgagtttgataattatcattcaactcatagtcaaataaacaaa
gaaattgttgaagatatctacggtaagctgaatgctcaaaaactcatatcaaaaaaagaa
atagctcaagcgtatgatcctgaagcaaagatgtttttaccagacagatttgtaaaaggt
acttgtccaaaatgtaaggctgaagatcaatacggagatagttgcgaggtttgcggtgca
acttatgatccaacagaactaataaacccaaaatcagtagtatcaggaaaagcaccaata
caaaaaaactctgaacacttcttttttgacctgcccgcattagaaaaagatattaaaaat
tggattgagtctaataaaagcctacaaccagaagtagctaataaattagcagaatggttt
gaacaaggattacaaagctgggatatatctcgtgatgcgccatattttggctatccaatc
cctggcacaaatgaacagaagttcttctatgtttggttagatgctccgatgggctacatt
gcaagcttcaaagattattgcaacaaaagtaatgttgatttcaatgaatttttgggagat
aactcttgtgaaagcgagctttatcactttattggtaaagatattatttatttccatgca
ttgttttggccggcaatactgtcatctacaggctacaaaactcctacaagtgtcttcgca
aacggattcttaaccgtaaatggcaaaaaaatgtcaaaatctcgcggcacatttatccaa
gccagaacatatcttgacaatctagagcctagttacttaaggtactactttgcctctaga
ctaacatctcgtatagatgatatagatttaaaccttgaagaatttgtcaccaaatcaaat
tctgatatagtcggtaaagtagtaaacatagcaagtcgttgtgctggctttatatacaaa
aaatttgatgcaactttagctaatgaagtctttgataaagagttggaagaagagtttgct
aaaaatcatcacgcaattacagaagcttttgagaaaagagaatttgcgcatgctgtaaga
ctaataatggccttggcagataaagcaaatcaattcatagatcatcataagccatggcaa
ctagctaaagaagaagatcaagagcaaaaagtccatcaagtatgctcacaaggaataaat
atgttcaaagttttagtctcatatctaaaacctataattcctagcattgttgcaaaagca
gaggcttttttaaatatagaaattgcaaactggaatgatactccaacattcttaaagaat
cataaaatcaacaaattcaaaccacttgctagacgtatagaaaaagaaaaagtagacaag
attttagaggatactaaaaaaatgctagaaaaagagcaatcacaaaaacagacagagcct
aaaaaagaagggtctaaacttgatatagctgaagaatgtacttttgatgacttcatgaaa
gtagaccttcgtgtagctagaattgctgaagcatcacatgttgaaggtgcagacaaacta
cttaggctaatattagatctaggcggagttacaaaacaagtatttgcaggcataaaatca
gcctataagccagaagatttggtaggcaaacatactgtaatggtagcaaacttagctccc
agaaaaatgaaatttggaatatcagaaggtatggttttagcagctggtgatggcaaagga
atatacatactagaaccgcatgaaggtgctcagcctggtatgcgtgttaaataa

DBGET integrated database retrieval system