KEGG   Francisella sp. TX077308: F7308_0573Help
Entry
F7308_0573        CDS       T01560                                 

Definition
(GenBank) Succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
frt  Francisella sp. TX077308
Pathway
frt00020  Citrate cycle (TCA cycle)
frt00190  Oxidative phosphorylation
frt00650  Butanoate metabolism
frt01100  Metabolic pathways
frt01110  Biosynthesis of secondary metabolites
frt01120  Microbial metabolism in diverse environments
frt01130  Biosynthesis of antibiotics
frt01200  Carbon metabolism
Module
frt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
frt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
frt_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:frt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    F7308_0573
   00650 Butanoate metabolism
    F7308_0573
  Energy metabolism
   00190 Oxidative phosphorylation
    F7308_0573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt DoxX
Motif
Other DBs
NCBI-ProteinID: AEI35500
UniProt: F8GA85
Position
567875..568228
Genome map
AA seq 117 aa AA seqDB search
MAVISLTSSGIKDFFVQRVTAVIIAAYFGYLIVEALCLSYSGTLNYDSWRGLFTDGMFFR
VATLMAYLAMFFHAWVGIWIICGDYIKCAWASALVMLSFVLVYVFCFFWLFAVLFFY
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaatttcattaacttcatcgggtattaaagacttttttgtacaaagagttact
gcagtaattattgcggcttattttggttatcttatcgttgaggctttatgtttgtcctac
tcaggaactcttaattacgatagctggagaggtttgtttactgatggtatgttcttcaga
gttgctacattgatggcttatttggcaatgttttttcatgcttgggtaggtatttggatt
atctgtggtgactacattaagtgtgcttgggcatcagctcttgttatgctgagttttgtt
ttagtttatgtattctgctttttttggttgtttgcagttttatttttttactaa

DBGET integrated database retrieval system