KEGG   Francisella sp. TX077308: F7308_0924Help
Entry
F7308_0924        CDS       T01560                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
frt  Francisella sp. TX077308
Pathway
frt00520  Amino sugar and nucleotide sugar metabolism
frt01100  Metabolic pathways
frt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:frt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    F7308_0924
Enzymes [BR:frt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     F7308_0924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AEI35851
UniProt: F8GBT4
Position
946971..948116
Genome map
AA seq 381 aa AA seqDB search
MKILTNCKIYSGLEILNNHSVVMNGQTIQDIIHNSNIKDYSDYEIIDLKGENIAPGFIDL
QVNGFGGFLLNDDVSEDCLKGIFESSKKYGATTVLPTLITTSDENILKALKLVRDYKDKY
QYNIPGLHLEGPYISRTKKGVHNIDHVRGPDSKIIDTIIEYADCVKILTLAPEVCDSSTI
KKLANAGITVSLGHTNATYEEAFNGIESGITMATHLYNAMSGYQGRNPGAIGAVLNSSNV
YAGIIADGFHLDYSSLEVAKKLLKEKLILVTDAAAPAGTDMEEFVFEGAVVYHKNGKLTT
ADGTLGGSALTMMGAVKNTVENTFIPLDEALRMASTYAAESINLGNLLGKIKSGYIANLV
IFDNSYNISKVVDKGEISTYG
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcctcacaaattgtaaaatatatagtggactagaaatattgaataatcattct
gttgttatgaatggccaaactattcaagatataatccataattctaatataaaggattat
tcagattatgaaattatagacttaaaaggtgagaatattgcaccaggattcattgacctg
caagtaaatggttttggagggtttcttctaaatgatgatgtcagtgaggattgtctaaaa
ggcatatttgagtcttcaaagaaatatggggcaacaacagtgctgccaacattgattaca
acttctgatgaaaatatcttaaaagcattgaaattggtgagggattataaagataaatat
caatataatattccaggtcttcatcttgagggtccctatattagcagaactaaaaaaggg
gttcataatattgatcatgttagaggacctgattctaaaattatagatacaataatagaa
tacgctgattgtgtgaaaattctgaccctggctccagaagtttgtgattcatctactatc
aagaaactagctaatgctggaataactgtttctttaggtcatacaaatgcaacttatgaa
gaagcatttaatggcattgaatcaggtataaccatggcaacacatttgtataatgctatg
agtggatatcaaggtagaaatcctggtgctataggtgcagtcctaaactcatcaaatgta
tatgctggaatcatcgctgatgggtttcacttagattattcatcattagaagttgctaag
aagttactcaaagagaaattaattcttgtaacagatgcagcagctccggcaggtacagat
atggaagaatttgtctttgagggcgcggttgtctatcacaaaaatggtaagctaactaca
gctgatgggactttgggtggatctgctttgacaatgatgggtgcggttaaaaatacagtt
gagaatacttttatacctcttgatgaggcactaagaatggcgtctacttatgcagcagaa
tcgattaatttagggaatttattagggaagataaagtccggatatatagcgaacttggtt
atatttgataatagttacaatatttcaaaggtagttgataaaggtgagattagtacttat
ggctaa

DBGET integrated database retrieval system