KEGG   Francisella sp. TX077308: F7308_1485Help
Entry
F7308_1485        CDS       T01560                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
frt  Francisella sp. TX077308
Pathway
frt00230  Purine metabolism
frt01100  Metabolic pathways
Module
frt_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:frt00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    F7308_1485
Enzymes [BR:frt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     F7308_1485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 MMR_HSR1 AAA_16 AAA_22 AAA_33 AAA_23 ABC_tran RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AEI36410
UniProt: F8G8J3
Position
complement(1507672..1508244)
Genome map
AA seq 190 aa AA seqDB search
MSNYIFIVSAPSGAGKSSLLKAFLETEIGKENFAVATSHTTRDPRIGETNGKEYHFVSII
EFEKMLDANGFIEYAKVFKNYYGTSKSEIDKLLAQGKNIILEIDWQGAQQTRFIYGNKAK
SIFILPPSMDELRKRLEIRNTDSKDIIDYRMSQAESEISHAGEYDYQLVNDDFSQSLEQL
CKYFEENIQS
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgagtaactatatttttatagtttctgcgccttctggtgctggcaaaagctccttacta
aaagcttttttagaaactgaaattggcaaagaaaattttgctgtggcaacatcacataca
accagagatcctcggataggtgaaactaatggtaaagagtatcattttgtttcaattata
gagtttgaaaagatgctagatgctaatggctttattgaatatgccaaagttttcaaaaat
tactatggcacatctaaatctgaaatagataaattacttgcgcaaggcaaaaatataatt
cttgagattgattggcaaggtgcccaacaaacaagatttatatatggaaacaaggcaaag
agtatatttattttacctccatctatggatgagttgagaaagcgtctagaaattagaaac
acagactctaaagacattatagactatcgaatgagtcaagcagagtctgaaatctctcat
gcaggtgagtacgattatcagcttgtaaatgatgattttagtcaatcattagaacaacta
tgtaaatatttcgaagaaaatatccaaagctaa

DBGET integrated database retrieval system