KEGG   Francisella sp. TX077308: F7308_1513Help
Entry
F7308_1513        CDS       T01560                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
frt  Francisella sp. TX077308
Pathway
frt00040  Pentose and glucuronate interconversions
frt00052  Galactose metabolism
frt00500  Starch and sucrose metabolism
frt00520  Amino sugar and nucleotide sugar metabolism
frt01100  Metabolic pathways
frt01130  Biosynthesis of antibiotics
Module
frt_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:frt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    F7308_1513
   00052 Galactose metabolism
    F7308_1513
   00500 Starch and sucrose metabolism
    F7308_1513
   00520 Amino sugar and nucleotide sugar metabolism
    F7308_1513
Enzymes [BR:frt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     F7308_1513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 RNA_pol_Rpb1_3
Motif
Other DBs
NCBI-ProteinID: AEI36438
UniProt: F8G8M1
Position
complement(1534906..1535769)
Genome map
AA seq 287 aa AA seqDB search
MKIKKAVFPVAGWGTRFLPATKSCPKEMLTVVDKPLIQYAVEEAIEAGCKEIIFVTSSNK
KSLEDHFDRNFELEYSLEKKQKYELLDLVKNIIPKDVSFFFVRQPEALGLGHAVLCAKPL
VGIEDFAVILPDDLVYNHDCGTGTLKQMVKAVEGTDIRGCIATQQVKRDETSSYGIVAKD
NENLIKAIVEKPAPEKAPSTNAVVGRYLLPNKIFRCLESTSEGAGGEIQLTDAIAKLLDQ
EEKILSYEFKGTRYDCGSKLGFLIANYEIALQHKELGDKFKEYLQNR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaaaaaagcggtttttcctgttgccggttggggaactagatttttaccagca
actaaatcatgtcctaaagaaatgctaactgttgtcgataaaccattgatccaatacgca
gttgaagaagccattgaagctggctgtaaggagataatttttgttacaagctcaaataaa
aagtctcttgaggatcattttgatagaaactttgagctagaatattcattagagaaaaaa
caaaaatatgagctactagatttagtcaaaaatataatcccgaaagatgtgagctttttc
ttcgttcgtcagcccgaagctttagggctaggtcatgctgtgctatgtgctaaacctctt
gtgggtatcgaagactttgctgtaatactgcctgatgatctagtatataatcatgattgt
ggcactggtacccttaaacaaatggtcaaagctgtagaaggtactgatattagaggttgt
atagctactcaacaagttaaaagagatgaaactagctcttatggtattgtagctaaagat
aatgaaaaccttataaaagcaatagttgaaaagccagctccagaaaaagcaccatcaaca
aatgctgtagttggaagatatttgctaccaaataaaattttcagatgtttagaatcaact
tcagaaggtgcaggtggggaaattcaactaacagatgcaatagctaaacttcttgatcaa
gaagaaaaaattctatcttatgagtttaaaggcactcgttatgactgtggtagtaaatta
ggatttttgattgctaattatgaaatagctcttcagcataaagaattgggtgataaattt
aaagagtatcttcaaaatagataa

DBGET integrated database retrieval system