KEGG   Francisella salina: F7308_1921
Entry
F7308_1921        CDS       T01560                                 

Definition
(GenBank) Aspartoacylase
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
frt  Francisella salina
Brite
KEGG Orthology (KO) [BR:frt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    F7308_1921
Enzymes [BR:frt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     F7308_1921
SSDB
Motif
Pfam: AstE_AspA ANAPC10
Other DBs
NCBI-ProteinID: AEI36845
UniProt: F8GAW9
Position
complement(1974547..1975416)
AA seq 289 aa
MKINKLLVSGGTHGNEYTGIYIVKRMEKYPPKTKSLDVIPLLANPEAFEISKRYKDQDLN
RCFSEEDLKKISLNSYEMQRAREINQMYGSESNSPVDFLVDLHTTTSNLGKTIITDGKSQ
FVNNLCSYLVEQIDDLRVIKHGSITSVAMNNIAPMSLTIEIGSVNTSIYDPNAIEVTTEI
VNGIIKFIELSNNGNAPEVKQCKAYEPFKTIQYPRDSEGNINVVIHKALHGKDFQIISSG
SPIFELIDGGDRLLDIEGEWYPIFINESAYYEKDIAFYLAKEVDLYSDS
NT seq 870 nt   +upstreamnt  +downstreamnt
atgaaaattaataagttactagtgtctggtgggactcatggaaatgaatatactggaata
tatatagtcaagcgtatggagaaataccctcctaaaaccaagtctttagatgttatacca
ttattggcaaatccagaagcttttgagataagtaagagatataaagatcaagatctaaac
cgttgtttttcagaggaagacttaaaaaagatctcgttgaatagttatgagatgcaaaga
gctcgagaaattaatcaaatgtatggctcagaatctaattctccagttgattttttagtc
gatctgcatacaacaacttcaaatcttggcaaaactattattactgacggtaaaagtcaa
tttgttaataacctatgctcttatttagttgagcaaatagatgatcttagagtaattaaa
cacgggagtattacaagtgtggcaatgaataatatcgctcctatgtctttaactatagaa
ataggctctgttaatacgagtatttatgatcccaatgcaattgaggtaactacagagatt
gttaatggaataataaagtttattgaattatcaaataatggtaatgctcctgaagtcaag
cagtgtaaggcgtacgagccatttaagactattcaatacccgcgagatagtgagggtaat
atcaacgtagtaattcataaagctcttcatggtaaagattttcagattattagtagtggt
agccctatttttgagttaatagatggaggagatagattgctagatattgaaggagaatgg
taccctatatttataaatgagtctgcgtactatgagaaagatattgctttttaccttgcc
aaagaagtagatttgtatagtgatagttaa

DBGET integrated database retrieval system