KEGG   Francisella sp. TX077308: F7308_1972Help
Entry
F7308_1972        CDS       T01560                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase / Phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
frt  Francisella sp. TX077308
Pathway
frt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
frt01100  Metabolic pathways
frt01110  Biosynthesis of secondary metabolites
frt01130  Biosynthesis of antibiotics
frt01230  Biosynthesis of amino acids
Module
frt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:frt00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    F7308_1972
Enzymes [BR:frt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     F7308_1972
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     F7308_1972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AEI36896
UniProt: F8GB98
Position
complement(2026311..2027672)
Genome map
AA seq 453 aa AA seqDB search
METILAKIVEAKRNWLFAKKRLFPLDVFKKEVIKTDRDFYQALESDKAVFILECKKGSPS
KGVIRKKFDLNEIAAVYKNYANVISVLTDEEFFMGSFANLEIVRKQVTQPILCKDFIIDE
YQIYLARHYQADAVLLMLSVLDDNEYKKLAKVANRLGMGILTEVSNEEELERAIKLKAKV
IGINNRNLRDLSIDLNTTRLLAPKIPKGTTIISESGIYKNQEIRDLRNYVNGFLIGSSIM
SERNLELAVRKLVYGFNKVCGLTSVENAQKAYNAGAVYGGFIFVEKSPRCVDFAMAKQIT
KKVRLNYVGVFANASIEDVVNTAYGLKLSAVQLHGDENQEYIDALKSKLHKNCQIWKAYG
IDKTVPEFFANVDYHLLDAQVDGKSGGTGKAFDWSLIKDRKNIILAGGLNPKNIAKAIEL
RCSAYDINSGVESEPGQKDQQKLKEVFEVIRDY
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggaaactatattagctaagatagttgaagcaaaaagaaattggctttttgcaaaaaaa
agattatttccactagatgtattcaaaaaagaagttataaaaacagatagggatttttat
caggctttagaatcagacaaagcagtatttattctagagtgtaaaaaaggatctccttct
aaaggagttatccgtaaaaaatttgatctaaatgaaatagcagcagtatataaaaattac
gcaaatgtaatatctgtacttacagatgaagaattctttatgggtagctttgcaaatcta
gaaattgttagaaagcaagtaactcaacctatactttgtaaagattttattatagatgag
tatcaaatatatttagctaggcattatcaagctgatgcagtgttactgatgctttcggta
ttagatgataatgagtataagaaactagcaaaagtagctaatcgtcttggcatgggtatc
ttaactgaagttagtaatgaagaagaacttgaaagagctatcaaactcaaagcaaaagtt
ataggtattaataatcgtaatctaagagatctttctattgatctaaatactacgcgtctt
ttggcgccaaaaatacctaaaggaacaactattatttcagaatcaggaatttataaaaat
caagaaatccgtgatttaagaaattatgttaatggttttttgataggtagttctattatg
agtgaacgcaatctagaacttgcagttagaaagcttgtatatggttttaataaggtttgt
ggtcttacctctgtagaaaatgcgcaaaaagcatataatgcaggagcggtgtatggagga
tttatatttgtagagaaatctcctcgctgtgtagattttgccatggcaaaacaaataact
aaaaaagttagattaaactatgtaggtgtatttgctaatgctagtattgaagatgttgta
aatactgcttatggtttgaaacttagtgcagtgcagttacatggtgacgaaaatcaagaa
tatatagatgcactaaaatcaaaactacataaaaactgtcagatatggaaagcttatgga
attgacaaaactgtcccagagttttttgctaatgtagattatcacttattggatgctcaa
gtagatggtaaatcaggtggtactggtaaagcttttgattggagtcttatcaaagacagg
aaaaatataatacttgctggtggtctgaatcctaaaaatatagcaaaagcaatagagcta
agatgttctgcttatgatattaattctggtgtagaatctgaaccaggacaaaaagatcag
cagaaattaaaagaagtttttgaggttataagagactactag

DBGET integrated database retrieval system