KEGG   Francisella sp. TX077310: F7310_01810Help
Entry
F7310_01810       CDS       T05017                                 

Definition
(GenBank) bifunctional 3-demethylubiquinol 3-O-methyltransferase/2-polyprenyl-6-hydroxyphenol methylase
  KO
K00568  2-polyprenyl-6-hydroxyphenyl methylase / 3-demethylubiquinone-9 3-methyltransferase [EC:2.1.1.222 2.1.1.64]
Organism
frx  Francisella sp. TX077310
Pathway
frx00130  Ubiquinone and other terpenoid-quinone biosynthesis
frx01100  Metabolic pathways
frx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:frx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    F7310_01810
Enzymes [BR:frx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.64  3-demethylubiquinol 3-O-methyltransferase
     F7310_01810
    2.1.1.222  2-polyprenyl-6-hydroxyphenol methylase
     F7310_01810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_31 Methyltransf_11 Methyltransf_25 Methyltransf_12 NodS PrmA MTS CMAS Ubie_methyltran DREV Methyltransf_32 Methyltransf_9 TPMT GidB MetW Methyltransf_18 RrnaAD Methyltransf_15 Methyltransf_4 AdoMet_MTase TehB Imm30 DUF43 Methyltransf_5 XPG_I_2
Motif
Other DBs
NCBI-ProteinID: API86164
UniProt: A0A1L4BQP9
Position
complement(364047..364748)
Genome map
AA seq 233 aa AA seqDB search
MSKLNIDNNEVNKFSSLAKTWWDANGELKTLHQVNPLRLEFVKKFTDLDNKNIIDIGCGG
GILTESLATPSNNVYGLDASPEAINVAKEHSKVSNLNIEYINSTIEDFTENNTVEFDVVT
CMEMLEHVPDPESIIASIAKIIKKDGMFFASTLNRNLKSYLLSIVAAEHILKMVPQGTHQ
YSKFIKPYELIKVAEKYGFEALEIIGIHYNPLLNNFKLGKGADINYIIAFKKV
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaattgaatatagataataatgaagttaataaattttcatcactagcaaaaact
tggtgggatgcaaatggcgagctaaaaactttacatcaagtaaatccgttgcgtttagag
tttgttaaaaaatttacagacttagataataaaaacattatagatatcggctgtggtggc
ggaatacttacagaatccttagcaaccccaagcaataatgtctatggtctagatgcatct
ccagaagctattaacgttgccaaagaacactctaaagtatctaatttaaatattgaatat
ataaactcgactatagaagattttactgaaaataacactgttgagtttgatgttgtaact
tgcatggaaatgcttgagcatgtaccagatccagaaagcattatagcttcaatagctaaa
attataaaaaaagatggtatgttttttgcctctacactaaatagaaaccttaagtcatac
ctactatcaatagtcgctgctgaacatattttaaagatggttccacagggaactcatcag
tacagtaaatttatcaagccttatgagcttattaaagttgctgaaaagtatggattcgaa
gcattagagattataggcatccactacaaccctcttttaaataattttaaactaggcaaa
ggcgcagatattaactatattatcgcattcaaaaaggtataa

DBGET integrated database retrieval system