KEGG   Francisella uliginis: F7310_08010Help
Entry
F7310_08010       CDS       T05017                                 

Definition
(GenBank) O-acetylhomoserine aminocarboxypropyltransferase
  KO
K01740  O-acetylhomoserine (thiol)-lyase [EC:2.5.1.49]
Organism
frx  Francisella uliginis
Pathway
frx00270  Cysteine and methionine metabolism
frx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:frx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    F7310_08010
Enzymes [BR:frx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.49  O-acetylhomoserine aminocarboxypropyltransferase
     F7310_08010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_5 DegT_DnrJ_EryC1 Aminotran_1_2 Beta_elim_lyase GDC-P
Motif
Other DBs
NCBI-ProteinID: API87311
UniProt: A0A1L4BTY2
Position
complement(1721645..1722955)
Genome map
AA seq 436 aa AA seqDB search
MSKYSLETLAVHRSIPEKSGSVQTPIHQTSSFVFESTEHAAKLFALEEFGSIYSRLTNPT
VDEYASRLANLHGATGGFACSSGHAAQLLILLNLLQSGDHIVASKYLYGGSITQLTHTFP
RQFGWQSTLVDINKLDEVRNAIQDNTKALYIESQSNPSGVIADIKALAEIAHEAGIPLIV
DNTVATPYLLNPIEHGADIVSYSLTKYLSGNGSIVGGAVVDSGNFDWTANDKFPLLSEPD
SSYNNISFAKAFGKLAFTVRGLAVGLRDIGATLSPHTAFLAIQGLETLGARLDRHVKNAE
IVAKFLNAHPKVKKVNYAGLVNSPYNLLANKYFTKGLVGLLTIELENGFEAGKNLVEQTK
LFTHCANIGDARSLIIHPASTTHSQLSEEEKLQSGISNGLVRLSVGLEDPNDLIEDLTQA
LEYSEVNYDGQCQKVI
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaatattctttagaaactttagcggtacatcgatctattccagaaaaaagtggt
tctgtacaaacaccgatacatcaaacatctagctttgtatttgaaagtacagagcatgca
gctaagctatttgcactagaagaatttggtagtatatattcacgcttaacgaatcctact
gtagatgaatatgcttcaagattagccaatttacatggtgcaactggagggtttgcttgt
tcatcaggtcatgctgcacagttgttgatacttttgaacttacttcaaagtggagatcat
attgttgcttcaaaatatttgtatggtggatctataacacaactaacacatacatttcca
agacagttcggttggcagtcaactctagttgatataaataaacttgatgaagtcagaaat
gctattcaagataatacaaaagcattgtatattgagtcgcaatcaaatccatcaggagtt
attgctgatataaaagctcttgcagagattgctcatgaggctggtattccactcattgta
gataacactgttgctacaccttatttactcaacccaattgagcatggtgctgatatagtt
tcttattctttaacaaaatatttaagtggtaatggttctatagttggtggggcagttgtt
gatagtggtaattttgactggacagcaaatgataaattccctttattatcagaaccagat
tcatcttataataatatctcttttgctaaggcatttggaaaacttgcttttactgttagg
ggattagctgtaggcttacgtgatattggagctacacttagtccacatacagcattttta
gcaattcagggtttagaaactttaggtgcaagactagatagacatgttaaaaatgctgaa
atagtcgcgaagtttttaaatgctcatccaaaagttaaaaaagtaaattatgcaggttta
gtaaactcaccatataatcttctagcaaataaatacttcacgaaggggttagttgggctt
ttgacaatagaattagaaaatggttttgaagcaggtaagaatcttgtggagcaaacaaag
ctatttactcattgtgcaaatattggtgatgctagaagtttgataatccatccagcatct
acaactcattctcaattaagtgaagaagaaaaattacagtcagggatttctaatggttta
gttagattatctgtaggtttagaagatcctaatgatttgattgaagatttaacacaagct
ttagagtattcggaggtgaattatgacggtcaatgtcaaaaagtcatttaa

DBGET integrated database retrieval system