KEGG   Francisella sp. TX077310: F7310_10265Help
Entry
F7310_10265       CDS       T05017                                 

Definition
(GenBank) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
frx  Francisella sp. TX077310
Pathway
frx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
frx01100  Metabolic pathways
frx01110  Biosynthesis of secondary metabolites
frx01130  Biosynthesis of antibiotics
frx01230  Biosynthesis of amino acids
Module
frx_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:frx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    F7310_10265
Enzymes [BR:frx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     F7310_10265
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     F7310_10265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C DUF4553
Motif
Other DBs
NCBI-ProteinID: API87712
UniProt: A0A1L4BV38
Position
complement(2228909..2230270)
Genome map
AA seq 453 aa AA seqDB search
METILAKIVEAKRKWLFAKKRLFPLDVFKDEVTKTDRSFYDALTSEKAVFILECKKGSPS
KGLIRKKFDLNEIASVYKNYANAISVLTDEEFFMGSFANLEIVRNQVTQPVLCKDFIIDE
YQIYLARHYKADAILLMLSILDDSEYRKLAKVANRLGMGILTEASNEEELQRAINLKAKV
IGINNRNLRDLSIDLNTTRLLAPKVPKGTIVISESGIYKNQEIRELRKFVNGFLVGSSIM
GERNLELAVRKIIYGFNKVCGLTSVENAQKAYNAGAVYGGFIFVKKSPRYVDFDMAKSIT
KKVKLNYVGVFANASIEDVVDASYKLKLSAVQLHGNEDQEYINILKSKLHRNCQIWKAYG
VDKTIPNFLDNVDYHLLDAQIDGQSGGTGKTFDWDLIKDKNNIILAGGLNSKNIAKAIEL
KCSAYDINSGVESQPGQKDQKKLNEVFEVIRNY
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggaaactatattagcaaaaattgttgaagcaaaaagaaaatggctttttgctaaaaaa
agactctttcctttagatgtttttaaagatgaagttactaaaacagatagaagtttttat
gatgctttgacttcagaaaaagctgtatttattttagagtgtaaaaaaggctctccttct
aaaggtcttattcgtaaaaaatttgatctaaatgaaatagcttcagtatataaaaattat
gcaaatgctatatcagtattaactgatgaagagttttttatgggaagttttgcaaattta
gaaattgtaagaaatcaagtaacacaacctgttctttgtaaagactttattatagatgaa
tatcaaatatacttagcaagacattataaagctgacgctatattattgatgctttctatt
ttagatgattctgaatatagaaaacttgctaaagttgctaatcgtcttggcatggggata
cttacagaagctagtaacgaagaagagcttcaaagagctataaacctaaaagcaaaagta
ataggtataaataatcgtaatcttagagatttatctatagacttaaatactactcgccta
ttagctcctaaagtaccaaaaggcactatagttatatctgaatctggaatttataaaaac
caagaaataagagaacttagaaaatttgtaaatggttttcttgtaggtagttctataatg
ggagagcgtaatttagaactagctgttagaaaaataatatatggttttaataaagtatgt
ggtcttacttcagtagaaaatgctcaaaaagcttataatgcaggagctgtttacggagga
tttatatttgttaaaaaatcacctcgttatgtagattttgacatggcaaaatctataaca
aaaaaagtcaaactaaactatgtaggtgtttttgctaatgctagtattgaagatgttgta
gatgcatcgtataagttaaagttaagtgctgttcagcttcatggtaatgaggatcaagaa
tatataaatattttaaaatctaaattacatagaaattgtcaaatatggaaagcttatggt
gtagataaaactattcctaacttcttagataatgttgattatcacttattagatgctcag
atagatggacaatctggaggtacaggaaagacgtttgattgggatcttataaaagataaa
aataacataatattagctggtggattaaactctaaaaatatagctaaagctatagagtta
aaatgctcagcttatgatattaactctggtgttgaatcacaaccaggtcaaaaagatcaa
aagaaattaaatgaagtttttgaagttattagaaattattaa

DBGET integrated database retrieval system