KEGG   Fastidiosipila sanguinis: C5Q98_06800Help
Entry
C5Q98_06800       CDS       T05345                                 

Definition
(GenBank) hypothetical protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
fsa  Fastidiosipila sanguinis
Brite
KEGG Orthology (KO) [BR:fsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C5Q98_06800
Enzymes [BR:fsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     C5Q98_06800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: AVM42934
UniProt: A0A2S0KPK3
Position
complement(1554299..1555297)
Genome map
AA seq 332 aa AA seqDB search
MRNKIYSLSRKAEVLKMSPEQLQELNQAGLEYMWEAMINGNTDLHTHSNVSDGKDSPAQL
VQEVIKRDLDTFSLTDHDTIEGFKIISILYDKLNLVGMDLPDFIPGLEMNAEFEGQDIQI
LAYFPFGTFYLMEDSVKERQARRNERNAKIMQKIDESGLIISADELKNMGGGVIGRVHIA
NLIMRKGYVDSINEAFRLYLDKGQAFYVEKELISIEETLKSIRDAGGIPVLSHPARYENW
LHGDNVISKDELFAKVERLKNMGLQGIEVMHLATSFADSREFAHIGTELGLLPIAGSDYH
GSHKANVPLRTQKDDPRKFLSLFYKEFRVSRL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaataaaatttattctttatcgagaaaagctgaagtcttgaaaatgagtccagag
cagttgcaggaacttaatcaagctggcctagagtatatgtgggaagctatgataaatggg
aatacagatttacatacacatagtaatgtatccgatggtaaggactcaccggcacaacta
gtgcaagaggtaattaaacgtgacctagatacattctccttgaccgaccacgatactata
gaaggtttcaagattatcagcattctttatgacaaattaaacctagttgggatggattta
cctgatttcattcctggattagagatgaatgcggagttcgagggacaagatattcagatc
ctcgcatatttcccttttggaacattttatttaatggaagatagcgtgaaagagaggcaa
gcccgtcgtaatgagcgtaatgctaagattatgcaaaagatcgatgaaagtggcttaata
atttctgcagatgagttaaaaaatatgggcggaggcgttattggtagagttcacattgct
aacttaataatgcgcaaaggctacgttgactcaataaacgaggcattcagattatattta
gataaaggtcaagctttttacgttgaaaaagagttaatttctatagaagagacactaaaa
tcaataagagatgcaggtggtattcctgtactttcccatcccgcaagatatgagaactgg
ttgcacggtgataatgtgataagcaaagatgaattatttgccaaagtcgagcgactcaag
aatatgggattacaaggaattgaagtaatgcatcttgcgactagttttgccgattctcgt
gaatttgctcatataggcactgaattgggattgttaccaatagctggatctgattatcac
ggtagtcataaagctaacgtgccattgagaacacagaaagatgatccacgcaagtttttg
agcttgttctacaaagagttcagagtatcacgtttgtaa

DBGET integrated database retrieval system