KEGG   Fibrobacter succinogenes: FSU_1303Help
Entry
FSU_1303          CDS       T02105                                 

Definition
(GenBank) glycosyl hydrolase, family 13
  KO
K01208  cyclomaltodextrinase / maltogenic alpha-amylase / neopullulanase [EC:3.2.1.54 3.2.1.133 3.2.1.135]
Organism
fsc  Fibrobacter succinogenes
Pathway
fsc00500  Starch and sucrose metabolism
fsc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fsc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FSU_1303
Enzymes [BR:fsc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.54  cyclomaltodextrinase
     FSU_1303
    3.2.1.133  glucan 1,4-alpha-maltohydrolase
     FSU_1303
    3.2.1.135  neopullulanase
     FSU_1303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ADL27045
UniProt: C9RNM2
Position
complement(1511389..1512648)
Genome map
AA seq 419 aa AA seqDB search
MTFPNWTKDAVFYQIFPDRFCRSAKYKAVGKFVDWDSLPTRENMFGGNLAGISEKLEYIA
SLGVNAIYLCPIFKSNSNHRYHTVDYFEIDPVLGTLKDFDKLVKKAHKLGLRVILDGVFN
HCSRGFFQFNSLMELGKNSPYVDWFHVHGWPLHAYSGKPNYDCWWGYPALPKFNTDNPDV
RDYLFSVGEYWMKRGIDGWRLDVPNEIDDDSFWQEFRRRIKAINPEAYIVGEIWDEPSRW
LQGDQFDGVMNYPLRKAVLAYLFDEKSIALAEFARRLQDAFPDGRFGVPMNLLGSHDTIR
LASLPCSNLQRVKLALALLFFLPGAPCIYYGEEIGMLGGKDPDNRRAFPWDKFPEMQKAP
VYDYLKGLIALRNKERVLRDGSLKIAYSSGRLEIVRTLGKKKLTLAVSPATPDPTFEIK
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgacatttcccaattggaccaaggacgctgttttctatcagatttttccggaccgcttt
tgccgtagtgcaaagtacaaggcggtcggaaagtttgtggattgggattcgctcccaacc
cgtgaaaacatgtttggcggaaatcttgcgggcattagcgaaaagcttgaatacattgca
tcgcttggcgtgaatgccatttacctttgcccgattttcaagagcaactcgaatcaccgc
taccatacggttgactattttgaaattgacccggttttagggacgctcaaggattttgac
aagcttgtcaagaaagcgcacaagcttggacttcgtgtgattctggatggcgtgttcaac
cattgctcgcgcggatttttccagttcaacagcttgatggaactcggcaagaattccccg
tacgtggactggttccatgtgcatggctggccgctccatgcatattcgggcaagcccaat
tacgattgctggtgggggtatcctgcactcccgaagtttaataccgacaatcccgatgtt
cgtgattaccttttctcggtgggcgagtactggatgaagcgcggcattgacggctggcgc
ctcgatgttccgaacgaaattgatgacgatagcttttggcaggaattccgccgccgcatc
aaggcaattaacccggaggcgtatattgtcggtgaaatttgggacgagccttcgcgctgg
ttgcagggggaccagtttgacggcgtgatgaattaccccttgcgtaaggcggtgcttgcg
tacctctttgatgaaaagtcgattgcacttgccgagtttgcaaggcgcttgcaagatgca
ttcccggacggtcgttttggcgtgccgatgaacttgctcgggagccatgatacgattcgc
ttggcgtcacttccatgctcaaatttgcagcgggtgaagcttgcgcttgcgctgttattc
tttttgccgggtgctccctgtatatattatggtgaagaaatcggcatgttgggcggtaag
gatcctgataatcgcagagcattcccgtgggataaattcccggaaatgcagaaggcgcct
gtctatgattatttaaagggtttgattgcgctccgcaataaggagcgtgtgctgcgcgat
ggctcgctcaagattgcttatagttcaggccgcctagaaattgtccgtaccctcggcaag
aagaaattgacgcttgcggtttcgccggcgacgccggaccctacgtttgagataaaataa

DBGET integrated database retrieval system