KEGG   Flexistipes sinusarabici: Flexsi_0608Help
Entry
Flexsi_0608       CDS       T01539                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
fsi  Flexistipes sinusarabici
Pathway
fsi00780  Biotin metabolism
fsi01100  Metabolic pathways
Module
fsi_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:fsi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Flexsi_0608
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:fsi01007]
    Flexsi_0608
Enzymes [BR:fsi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     Flexsi_0608
Amino acid related enzymes [BR:fsi01007]
 Aminotransferase (transaminase)
  Class II
   Flexsi_0608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_3 OKR_DC_1
Motif
Other DBs
NCBI-ProteinID: AEI14286
UniProt: F8E3L3
Position
622769..623914
Genome map
AA seq 381 aa AA seqDB search
MIASIKDNLEDIKSKGLYRNLPPIAKSHTKYTIFNGEEKLNCASNDYLGLSHNDQVKEAA
AEALRMYGNSSGSSRIVAGNYDLYDKLEYETAKFKNYESCLTVNTGYTANLLIISTLADS
RSIVFTDKLNHASIYDGIKLCGAKMVRYKHNDMNHLETLLKKYDKYPNKILITDTIFSMD
GDKARLKEIRKLKYKYNFLFVIDEAHATGIFGEGRGIAHEEGVEKDIDINMGTFSKALGG
FGAYICADKNIIKYLINKGRSFIFTTSLPPSVIGGNVKSVEIVSKEHEKYGGRLLDNCRI
FTNLLATLNIDHEKSNSQIFPFFFKDNNSALEVQKKLLDSGVYALLARRPSVTTPRLRIS
LRADFTNEDIVKIVKCLKKII
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgatagcctctattaaagataatttggaagatataaaatcaaaagggctctacagaaat
ttaccacccattgcaaaatcgcacactaaatataccatctttaatggtgaagaaaaacta
aattgcgccagtaatgattatctggggctctcacacaacgaccaagtaaaagaagctgca
gcagaagctctgagaatgtatggtaattcttccggaagttcgagaatagtagctggtaac
tatgacttatatgataaactggaatatgagacagcaaagtttaaaaattatgaatcatgt
ctgactgttaataccggatacaccgccaacttacttataataagtactcttgcagattcc
cgcagtattgtttttacagataaattaaatcatgccagcatatatgacggtattaaatta
tgtggtgccaaaatggtaaggtacaaacataacgatatgaatcatttggaaacgctgctc
aaaaagtacgataaatatccgaataagatattaataactgacacaatattcagtatggac
ggggataaagcaagacttaaagagataagaaaattaaaatacaaatataattttttattt
gtaatcgatgaagctcatgctacaggaattttcggtgaagggcggggaatagctcatgag
gaaggtgttgaaaaggatattgatataaatatgggaacgttcagcaaggcattgggagga
tttggcgcttatatatgtgcagataaaaatattattaaatatcttataaataaaggcaga
agttttatttttacaacatcgctacctccttctgtaatcggtggaaatgtaaaatcggtg
gaaattgtaagtaaggaacatgaaaaatacggggggagattgttagataactgcagaatc
tttacaaatcttcttgcaacgctgaatattgaccatgagaaaagtaacagtcagatattt
cctttcttttttaaagataataattcagctttggaagtacaaaagaaactgttggattca
ggtgtatatgcacttctcgccaggagaccttcagtgaccactccacgattgagaatcagt
ttaagagcagattttacaaatgaggatattgttaaaattgtcaaatgtctgaagaaaata
atttaa

DBGET integrated database retrieval system