KEGG   Flexistipes sinusarabici: Flexsi_1063Help
Entry
Flexsi_1063       CDS       T01539                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
fsi  Flexistipes sinusarabici
Pathway
fsi00010  Glycolysis / Gluconeogenesis
fsi00052  Galactose metabolism
fsi00500  Starch and sucrose metabolism
fsi00520  Amino sugar and nucleotide sugar metabolism
fsi00521  Streptomycin biosynthesis
fsi01100  Metabolic pathways
fsi01110  Biosynthesis of secondary metabolites
fsi01120  Microbial metabolism in diverse environments
fsi01130  Biosynthesis of antibiotics
fsi01200  Carbon metabolism
Module
fsi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Flexsi_1063
   00052 Galactose metabolism
    Flexsi_1063
   00500 Starch and sucrose metabolism
    Flexsi_1063
   00520 Amino sugar and nucleotide sugar metabolism
    Flexsi_1063
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Flexsi_1063
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Flexsi_1063
Enzymes [BR:fsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Flexsi_1063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK TCR
Motif
Other DBs
NCBI-ProteinID: AEI14720
UniProt: F8E612
Position
complement(1117636..1118535)
Genome map
AA seq 299 aa AA seqDB search
MDFLCVDIGGTTIKYGVISKDMLLKEFYTVPTPKNYKEFIEEIKNITTRFSHTKAVGVGY
PGAYDFENDLMLYAPNLDFLNGRKLQAEIAKFIDNPVFIENDANLAALGEYTIIEQGAVD
NMLFITLGTGVGGGAIVNRLLFTGSITAFEAGHTSIDYNGRQCNCGRLGCLETYCSESGI
LTTFEEISQNRKSDISNLTQLAEYGNKSAVKTFDLFSKHLAAGIADCINLLAPEKVKIGG
GLSHLHRFFLDITEQNLKKLVYPAYGNRFKLLPAELDNKAGVYGAAALCKQRYRDVQKP
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggactttctgtgtgttgatatcggaggaacaacaataaaatacggagtaatctccaaa
gatatgttactgaaggaattttacaccgtgccgacccctaaaaactataaagagtttatt
gaggaaattaaaaatatcacaacccgcttttcccacacaaaagccgttggagtggggtat
cccggagcttacgattttgagaatgatttaatgctttatgctccgaatcttgatttttta
aatggcagaaagctgcaggcagaaattgcaaaatttattgataatcccgtttttatagaa
aatgatgcaaaccttgccgccttaggagaatacaccatcattgaacaaggagctgttgac
aatatgctgtttataacacttgggacaggagtgggcggcggcgctatagttaacagactg
ctttttactggcagcattacagcttttgaggccggtcatacatcaattgattacaacgga
cggcaatgcaactgcggcagactgggctgccttgaaacttactgcagcgaaagcggaata
ctaacaacttttgaagagatatcccaaaaccgaaaatccgatataagtaacttgactcaa
ttggctgaatatggaaataagtctgccgtaaaaacgtttgatttgttttcaaagcattta
gctgccggtatcgccgattgtataaatctcctggcaccggaaaaggtaaaaataggcgga
ggcctgtcacatctgcatagattttttcttgatattacagaacagaatctgaaaaagctt
gtttatccggcatacggaaataggttcaaactgctcccggctgagttggacaacaaagcc
ggtgtatatggagcagccgctttgtgtaaacaaagataccgtgatgtgcaaaagccgtga

DBGET integrated database retrieval system