KEGG   Flexistipes sinusarabici: Flexsi_1401Help
Entry
Flexsi_1401       CDS       T01539                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
fsi  Flexistipes sinusarabici
Pathway
fsi00030  Pentose phosphate pathway
fsi01100  Metabolic pathways
fsi01120  Microbial metabolism in diverse environments
fsi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Flexsi_1401
Enzymes [BR:fsi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Flexsi_1401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AEI15051
UniProt: F8E7Y3
Position
complement(1498998..1500800)
Genome map
AA seq 600 aa AA seqDB search
MTGGWAGKILRIDLSNEKYSVEDLNLDAAKKFIGGRGLAVKYFTDEVPADVDAYSDKNKV
FLAVGPLTGTYGAANGRYMVVTKSPLSGTIASSNSGGYFPSELKYAGYDMIILEGKAKNP
VYITIYNNNIEIRSAKKLWGKTTHETEDIIHKTFHQDAKIASIGPAGEKQVKFACIMNDK
HRAAGRSGVGAVLGSKNVKAIAVRGTGGVKISDKDAYRKSAFEAYKLLKDSPVTSQGLPA
YGTAVLVNVINETGLFPTNNFQRDTFAKAEDISGETMADTILKRNKACMGCIIGCGRVTA
ISDPRFSGEGEGPEYEPIWALGADCGISDLKAIARANYICNENGFDPITAGGTIACAMEM
YEKGIISKDEIGRSLEFGDAEGMVEMMEKIANREGFGDKLAEGSYRLAEEYGKPDYSMSV
KKLEFPAYDGRVAQGMAINYATSNRGACHVRGYMISPEILGVPEKMEPTSLEGKAEWTKA
FQDVTALVDSSGICLFTTFAITPEEIKNFFNAATGLNYSADDLVEAGERVWNLERLYNLD
AGIDPSQDTLPKRILEEPVPDGPHKGSVARLSETLPKYYEARGWKDGIPTSEKLAELGLR
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcggctgggcaggaaaaatattaaggatagatttatccaatgaaaagtacagt
gttgaagatttgaaccttgatgctgctaaaaagtttataggcggaagaggattggccgtt
aaatattttacggacgaagtacctgcggatgtggatgcatatagtgacaaaaataaagta
tttctggctgtcggccctctgacagggacatacggtgctgccaacggacggtatatggtt
gtaacgaaatctccgctgtcaggtacaattgcatcttcaaattcaggcggatactttcct
tcggaacttaagtatgcagggtatgatatgattattttggagggaaaggcgaagaatccc
gtttatataacaatctataataataatattgaaatcagaagtgctaaaaaactttggggg
aaaaccacccacgaaacggaagatattatccataaaacatttcatcaggatgcaaaaata
gcatcaataggtcctgctggagaaaagcaggtgaagtttgcatgtattatgaacgataag
cacagagcagccggaagaagcggtgtcggtgctgttttgggcagtaaaaatgtcaaggcc
attgctgtcagaggtacaggcggggtgaaaatctccgacaaagatgcttacagaaaatca
gcatttgaggcatataaattactgaaagattcccccgtaacttctcaggggcttccggcc
tacggtactgcagtactggtaaatgttatcaacgaaacagggcttttccccactaataat
ttccagagagacacattcgcaaaagcagaagatatttccggtgaaacgatggcggatacc
attttaaaaaggaataaggcgtgtatgggatgtattatcggctgtggaagagttacggca
atttcggatccaagattcagcggcgaaggtgaagggcctgaatatgagcctatctgggcg
ctcggagccgactgcgggattagtgatctgaaagcaattgccagggctaattatatatgc
aatgaaaacggattcgatcccataactgcagggggtactatagcatgtgcaatggagatg
tatgaaaagggaataatcagtaaagatgaaataggaagatccctggaatttggcgacgca
gaaggtatggtggaaatgatggaaaaaatagccaacagggaaggtttcggcgacaaactg
gcagaaggctcttacaggctggctgaagaatacggcaagcctgattattccatgagtgtg
aaaaaacttgagtttcccgcttatgacggaagagttgcccagggaatggcaataaattat
gccacaagcaacagaggggcctgccacgtcagaggctatatgatttcccctgaaattctc
ggagtacctgaaaaaatggaacccaccagtcttgagggaaaggccgaatggacaaaggct
tttcaggatgttacggcgcttgtggattcctccggaatatgcctttttacaacatttgcc
ataacccctgaagagattaaaaacttttttaatgctgctacgggattgaattattctgcc
gatgatcttgttgaagccggtgaaagggtgtggaatctggaaagactgtataatcttgat
gccggtatcgatccttctcaggatacacttcctaaacggattcttgaagaacctgttccg
gacggacctcataaagggtcagtggccagactgagtgagacgcttcctaaatattacgaa
gcaagaggttggaaggatggaatccctacatcagaaaaacttgcagagcttggactaaga
taa

DBGET integrated database retrieval system