KEGG   Flexistipes sinusarabici: Flexsi_2038Help
Entry
Flexsi_2038       CDS       T01539                                 

Definition
(GenBank) Methylenetetrahydrofolate--tRNA-(uracil-5-)-meth yltransferase trmFO
  KO
K04094  methylenetetrahydrofolate--tRNA-(uracil-5-)-methyltransferase [EC:2.1.1.74]
Organism
fsi  Flexistipes sinusarabici
Brite
KEGG Orthology (KO) [BR:fsi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:fsi03016]
    Flexsi_2038
   03036 Chromosome and associated proteins [BR:fsi03036]
    Flexsi_2038
Enzymes [BR:fsi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.74  methylenetetrahydrofolate---tRNA-(uracil54-C5)-methyltransferase (FADH2-oxidizing)
     Flexsi_2038
Transfer RNA biogenesis [BR:fsi03016]
 Prokaryotic Type
  tRNA modification factors
   Methyltransferases
    Flexsi_2038
Chromosome and associated proteins [BR:fsi03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    Flexsi_2038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GIDA Pyr_redox_2 DAO NAD_binding_8 FAD_binding_2 3HCDH_N AlaDh_PNT_C Pyr_redox Pyr_redox_3 HI0933_like FAD_oxidored NAD_binding_2 FAD_binding_3 NAD_Gly3P_dh_N K_oxygenase DpaA_N Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AEI15666
UniProt: F8E530
Position
2183077..2184411
Genome map
AA seq 444 aa AA seqDB search
MRNNVKTITIIGGGLAGTEAAYQLAEHGFNVKLYEMRPDKMTPAHSTGFLGELVCSNSLK
SESLSTGSGLLKAELDKLGSIIIKTAQETRVPAGNSLAVDRQALARQLTEIIKQHENIEI
INEEIKDIPADRPLIIATGPLTSDSFAQTLMKELVSEELFFYDAIAPVISADSIDYNHCF
FKSRYDKGEADYLNCPLDKKTFELFYNELLDAEKVPLKDFEEASVFEACMPLEEMAERGE
KTLTFGPLKPVGLDHPDTGDKYYAVLQLRKENKKGTAYNLVGCQTKMKIPEQKRVFRIIP
ALRNAEFLRYGSIHRNTYINSPLYLANNYRMKEQDIYFAGQITGVEGYIESIASGLTAAY
DLIFRLLLDKQLNFPETTALSALQRYVQEYKNKYTPSNFHFGLLPRLEEKIKKKKLKKEK
LSERSLKDLQRYWVDNYENRQSSR
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgagaaacaatgtcaagacaataaccattatcggcggcggcctggccggcacggaagcc
gcgtatcagctggctgaacacgggtttaatgtaaagctttatgaaatgcgccccgataaa
atgactcccgcccactccactggtttcctgggagagcttgtttgctcaaactctctcaaa
tcagaatcactttccaccggcagcggccttttgaaagcagagcttgataaactgggcagt
attattattaaaactgctcaagaaacaagagttcccgccggaaattctcttgccgttgac
agacaggcacttgccagacaactcacagaaattataaagcagcatgaaaacattgagata
ataaatgaagaaataaaagatattcctgcagacaggcctttgataatcgccacaggcccg
ctgacttccgactcatttgcccagactctaatgaaagaactggtatcagaggaattattt
ttttacgatgcaattgcccctgttataagtgccgattcaatcgattataaccactgcttc
tttaaaagccgttatgacaagggtgaggcagactatttaaactgccccttagacaaaaaa
acttttgaacttttttataacgagcttttggatgcggagaaagtgcctttaaaagatttt
gaggaagcttccgtatttgaagcctgtatgcctcttgaagaaatggctgaaaggggtgaa
aaaacactcactttcggcccgttaaagcccgtaggtctcgaccacccggataccggggat
aaatactatgctgttcttcagcttagaaaggaaaataaaaaaggtacggcatataatctt
gtaggatgtcagacaaagatgaaaattcccgagcagaaacgtgttttcagaataatacct
gctttaagaaatgctgaatttctcagatacggctccatccacagaaatacatatattaac
tcacccctttatcttgcaaataattacaggatgaaagaacaagacatctatttcgcagga
cagataacaggtgtggaaggttacattgaatcgatagcaagcggcttaaccgctgcatac
gatctgatattcaggctgcttttggacaaacagctaaactttcctgaaaccactgcactt
tcagccctgcagcgttatgttcaggagtataaaaacaaatacaccccttcgaactttcat
ttcggtctgcttccccggcttgaagaaaaaatcaaaaagaagaaattaaaaaaagagaag
ctgagcgagaggtcactgaaggatcttcaaagatactgggtggataactatgagaatcgg
cagagcagtagataa

DBGET integrated database retrieval system