KEGG   Flexistipes sinusarabici: Flexsi_2311Help
Entry
Flexsi_2311       CDS       T01539                                 

Definition
(GenBank) Butyrate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
fsi  Flexistipes sinusarabici
Pathway
fsi00010  Glycolysis / Gluconeogenesis
fsi00620  Pyruvate metabolism
fsi00640  Propanoate metabolism
fsi00680  Methane metabolism
fsi01100  Metabolic pathways
fsi01110  Biosynthesis of secondary metabolites
fsi01120  Microbial metabolism in diverse environments
fsi01130  Biosynthesis of antibiotics
fsi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fsi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Flexsi_2311
   00620 Pyruvate metabolism
    Flexsi_2311
   00640 Propanoate metabolism
    Flexsi_2311
  Energy metabolism
   00680 Methane metabolism
    Flexsi_2311
Enzymes [BR:fsi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Flexsi_2311
Lipid biosynthesis proteins [BR:fsi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Flexsi_2311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEI15925
UniProt: F8E6N5
Position
complement(2483468..2485102)
Genome map
AA seq 544 aa AA seqDB search
MHNMKNYEKTIKEFNIDVPHFFNFGFDVVDKNAETKDNTALIWIDTDGETHEKYTFGDLK
RMSNRFANVLKEQGFKKGDNLYVMVPRVPEWYSVMLGCFKLGVIPMPAPKILREKDIDYR
LKASKARGAVVYGDSIEKFGNLSTPDNFTKIAIKYESKGWQNYEDLMAKAGEYLSREDVE
PTKSTDPLIIYFTSGTTKFPKMVLHDQTYALGHYITARFWQDLTEDDIHWTLSDTGWGKA
VWGKLFGQWLIGTTVVMHNQSDRFDPELHLNILQNFGVTTFCAPPTAYRMLILQDLSKYD
FSKLRHSVSAGEPLNPEVIRKWKEHTKTLIYDGYGQTETVNTVANYPCLEVKPGSMGKPA
PGFTVDIVDDEANPMPFNEAGHIAIKAEGKNQVGIFRGYYRDEEATNAAFHNGWYFTGDK
AYKDEDGYFWFVGRSDDVIKSSGYRVGPFEVESALQTHNAVAESAVIGAPDKLRGTIVKA
FIVLKPGFEGSDELITDIQEHVKNETAPYKYPREIEFVDNLPKTVSGKIRRVELRQMEEN
RRRH
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgcacaacatgaaaaattatgaaaaaacaatcaaagaatttaacatcgatgtgcctcat
ttcttcaatttcggttttgatgttgtggacaaaaatgccgaaacaaaggataacactgca
ttaatctggatcgatacggacggtgaaacccatgaaaaatatacatttggcgatttaaaa
agaatgtccaacagatttgcaaatgtattaaaagaacagggctttaaaaaaggtgacaat
ctgtatgttatggttcccagagtgcccgagtggtactcagtcatgcttggctgctttaag
ctcggggttatacctatgccggctccaaaaattttaagggaaaaggatattgactaccga
cttaaagcttcaaaagcacgcggagcagttgtctacggtgattcaatagaaaaattcggg
aatctgtcaacacctgacaattttactaaaatagccataaaatacgaaagcaaagggtgg
cagaattatgaggatcttatggcaaaagccggggaatatctgtcgcgggaagatgtggaa
cccaccaaatccacagatcctctgataatctattttacaagcggtaccacaaagtttccc
aaaatggtacttcacgatcagacatatgccctcggccattacattactgcaaggttctgg
caggatcttactgaagatgatatacactggactctgagtgatacagggtggggaaaagct
gtatggggcaagctgttcggacagtggctgatcggaacaacggtagtaatgcacaatcag
tccgacagatttgacccggaactgcatctgaacatactgcaaaatttcggagtaaccaca
ttctgtgcaccccccacagcatacagaatgcttattctgcaggatttatcaaaatacgat
ttttcaaaactcagacactccgtcagtgcaggagagccgctgaatcctgaagttatcaga
aaatggaaggagcatacaaaaacccttatttacgacggatacgggcagacggaaactgtc
aatactgtagccaattatccgtgcctggaagtaaaacccggctcaatgggcaagccggcc
ccaggatttactgtagatatagttgatgacgaagcaaatcccatgccgtttaacgaagcg
ggacatattgcaataaaagcggaaggaaaaaatcaggttggtattttcagagggtattac
agagatgaagaggccacaaatgcagcattccataacggatggtactttacaggcgacaag
gcttataaggatgaagacggttatttctggtttgtgggaagatccgatgatgtgataaaa
tcaagcggatacagagtgggcccttttgaagtggaaagtgctttgcagacacataacgca
gttgcagaaagtgccgttataggagcgcctgacaaactgaggggaacaattgtaaaagct
tttattgtactaaagcctggctttgaaggcagtgatgagctcatcacggacatacaggag
catgtaaaaaatgagacagcaccatataaatacccccgggaaattgaatttgtagataat
ctgccgaaaacggtaagcggaaaaatcagaagggttgagctcaggcagatggaggaaaac
cgcagaagacattaa

DBGET integrated database retrieval system