KEGG   Flaviflexus salsibiostraticola: EJO69_02370Help
Entry
EJO69_02370       CDS       T05752                                 

Gene name
coaBC
Definition
(GenBank) bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
fsl  Flaviflexus salsibiostraticola
Pathway
fsl00770  Pantothenate and CoA biosynthesis
fsl01100  Metabolic pathways
Module
fsl_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:fsl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    EJO69_02370 (coaBC)
Enzymes [BR:fsl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     EJO69_02370 (coaBC)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     EJO69_02370 (coaBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AZN29273
UniProt: A0A3S8Z745
Position
503519..504754
Genome map
AA seq 411 aa AA seqDB search
MVERAHGDTAGPSRIVLGVTGGIAAYKSAIVARLLMKAGHDVRIVPTESALKMVGETTFA
ALTGRPVHTTVWDDAEGVEHVRVGAEADLIVIAPATANTIAKLAAGIADNLLTATALVAT
CPIMIAPAMHTQMWNHPATQANVATLRERGVRVLEPAEGRLTGADSGVGRLPEPEHIVQA
ALGLLYDQDLEGERYVISAGGTREPIDPVRFLGNRSTGRFGVALALAAAHRGADVDLVAC
NVDAALLPHHPRITIHAAGTALELRERMLGLAPCAQVLIMTAAVADFRPATTTDSKVKKG
GSVPDFELVENPDILKGLAADRSHGAFVVGFAAETGDEGGSVLDYGRAKARAKGADLLVV
NRVGETAGFGDVDTAITILDSAGETRSDAAGTKSQMAGVVIDTISSARKGV
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggttgaacgggcccacggtgataccgcgggcccgtctcgcatagtccttggggtgacg
ggcggcatcgccgcctacaagtccgcgatcgtggcccgcctcctcatgaaggcgggtcat
gacgtccgcatcgtcccgaccgagtcggcgctcaagatggtgggggagacgaccttcgcc
gccctcacgggccgccccgtccatacgacggtgtgggatgacgccgagggcgtcgagcat
gtccgcgtcggcgccgaggccgacctcatcgtcatcgcccccgcgacggccaacacgatc
gccaagctcgccgcgggtatcgccgacaacctcctgaccgcgacggcgctcgtcgccacg
tgcccgatcatgatcgccccggccatgcacacgcagatgtggaaccatccggcgacccag
gcgaatgtggcgaccctgcgcgagcggggcgtccgcgtgctcgaaccggccgagggccgc
ctcaccggcgccgactccggtgtcggcagactgcccgagcccgagcacatcgtccaggcc
gcgctcggcctcctgtacgaccaggatctcgagggcgagcggtacgtcatctccgccggc
ggcacccgcgagccgatcgatcccgtccgcttcctcggcaatcgctcgaccggccgcttc
ggtgtcgccctcgctctcgccgcggctcaccgcggtgcggacgtcgacctcgtcgcctgc
aacgtcgacgctgccctgctgccgcaccacccgaggatcaccatccacgcggccggcacg
gcgcttgagctgcgcgagcggatgctcgggctcgcaccgtgcgcgcaggtcctcatcatg
accgcggcggtcgccgacttccggcccgcgacgacgacggactcgaaggtgaagaagggc
ggctccgtgcccgatttcgagctcgtcgagaacccggatatcctcaagggcctcgcagcc
gaccgctcgcacggcgcgttcgtcgtcggcttcgccgcggagacgggcgatgagggtggg
agtgtcctcgactatggccgggccaaggcgcgggccaagggcgccgacctcctcgtcgtc
aaccgggtcggcgagaccgccgggttcggcgacgtcgacaccgcgatcacgatcctcgac
tcggcgggcgaaacccggtccgacgcggcggggacgaagtctcagatggcgggagtcgtc
atcgacacgatctcttctgccagaaagggcgtttag

DBGET integrated database retrieval system