KEGG   Flaviflexus salsibiostraticola: EJO69_06730Help
Entry
EJO69_06730       CDS       T05752                                 

Gene name
tilS
Definition
(GenBank) tRNA lysidine(34) synthetase TilS
  KO
K04075  tRNA(Ile)-lysidine synthase [EC:6.3.4.19]
Organism
fsl  Flaviflexus salsibiostraticola
Brite
KEGG Orthology (KO) [BR:fsl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:fsl03016]
    EJO69_06730 (tilS)
Enzymes [BR:fsl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.19  tRNAIle-lysidine synthase
     EJO69_06730 (tilS)
Transfer RNA biogenesis [BR:fsl03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    EJO69_06730 (tilS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP_bind_3 TilS
Motif
Other DBs
NCBI-ProteinID: AZN30036
UniProt: A0A3S8Z9M2
Position
complement(1457172..1458179)
Genome map
AA seq 335 aa AA seqDB search
MGFARAVLAARQAVRAVLAELDPGTSVLVACSGGSDSLAVALAVAAEAEPAAVLPRAVTI
DHGILPGSAERAAELVEVLERHMPARSIRIDPSGAEGPEGSARTERYRAIAGEARRVGGP
ALVLLGHTLDDQAETVLMGLGRGSGPRSIAGMRPRGLLPGTDDVPFARPFLALTRVALQD
ALRGWGASWWEDPSNRADGPWRAADGRPLRRAAVRDRALPALSEALGLDVRGPLARTASL
LQDDLDYIDGAADAALAGARAGEGLALEALRPLHAAIRTRVLRAWLLGLGARAGELTGWH
VAAVDRLLDGETGKGIDVPGLRVARTRDCLVPVVE
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtgggcttcgcgcgtgctgtcctagccgcgcgccaggcggttcgtgccgtcctcgccgag
ctcgaccccgggacctctgtgctcgtcgcctgctccggcggttcggactccctggccgtg
gcgctcgccgtcgccgcagaggccgagcccgccgccgtccttccccgtgcggtgaccatc
gaccacggcatcctccccggatcggcggagagagcggcggagctcgttgaggtgctggag
aggcacatgcccgcccgatcgatccgcatcgacccctccggcgccgaaggccccgagggc
agcgcccggacggagcgataccgggcgatcgccggcgaggcccgcagggtcggcgggccc
gccctcgtcctcctcgggcatacgctcgacgatcaggccgagaccgtgctcatgggactc
ggccgggggagtggcccccgctcgatcgccggcatgaggccacggggcctgctgccgggc
acggatgatgttcccttcgcccggcctttcctcgcactgacccgggtggctctgcaggat
gctctgcggggttggggtgcctcgtggtgggaggatccctcgaatagagccgatgggcca
tggcgcgcggccgacggtcggccgctgcggagggccgccgtgcgggatcgggcgctgcct
gccctgtcggaggcgctgggtctcgacgtgcgtgggccgctcgctcggacagcgtcgctc
ctccaggacgatctcgactacatcgacggggcggccgacgccgccctcgccggtgctcgc
gcgggcgaggggctggcgctcgaggcgctgaggcccctgcacgccgcaatccggacgcgc
gtgctgcgggcctggctgctgggtctcggggcgcgggccggtgagctgaccggttggcac
gtggcagccgtggaccggctcctcgatggtgagaccggcaagggcatcgacgttcccgga
ctgcgcgtagcgagaacacgcgactgcctcgtgccggtcgtggagtag

DBGET integrated database retrieval system