KEGG   Candidatus Fokinia solitaria: Fsol_00695Help
Entry
Fsol_00695        CDS       T05415                                 

Definition
(GenBank) Ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
fso  Candidatus Fokinia solitaria
Brite
KEGG Orthology (KO) [BR:fso00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:fso03009]
    Fsol_00695
Enzymes [BR:fso01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     Fsol_00695
Ribosome biogenesis [BR:fso03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    Fsol_00695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: AWD33471
UniProt: A0A2U8BSZ5
Position
complement(764020..765114)
Genome map
AA seq 364 aa AA seqDB search
MSVCRLCVDDDSVGERIDTFIFHNIEALSAYDNVLYSRNSVQNLIAYGCVSCNESVILKS
SYRVRKNDVIQISFTAKDYAANIVTAKKSINDVFAEYDIRLLYEDEHFLAIDKPANLVVH
HGAGTSKLITLTDILSHVADLQLSFNESFRAGIVHRLDKDTSGVMLIAKTEVFHNKISDK
IQNKEVRRKYICFVHGMPIPPVMKLTSYIAKDRCASSVKMKSTDDESGKYAVTNYRLLGS
IFDVLSAIECELETGRTHQIRVHMSEHGHPIIGDLIYSKERCIKHLIMKLQKCANKSDMS
DMNATEIIDETINELTRVRRQLLHSKAISFVHPITHQHLIIKAQLRDDMLKLATCTISPS
YSEF
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtatgtagattatgtgtggatgacgacagtgttggagagaggattgatacattt
atatttcacaatattgaagcactttcggcatatgataatgttctctattcgagaaattca
gtacagaatctaattgcatatggatgtgtatcatgtaatgagagcgtcattctcaaatca
tcttacagagttagaaaaaacgatgtaatacaaatttcttttacggcaaaagattacgct
gcaaatatagtcactgcaaagaaaagtataaatgatgtttttgcagaatatgatatacgg
ctgctttatgaagatgaacattttcttgctatagataaaccagctaaccttgtagtgcat
catggtgctggaacttccaagcttattactctaactgatatattatctcatgttgcagat
ttgcaattatcttttaatgagtcttttcgtgcaggtatagtgcatcgcttggataaagat
acaagcggagtaatgcttattgccaagacagaagtatttcataataaaatttccgataaa
atacagaataaagaagtaaggagaaagtacatatgttttgttcatggtatgccgattcct
ccagtaatgaaacttacgagttatattgcgaaagatagatgtgcaagtagtgtaaagatg
aaaagtacagatgatgaaagtggaaaatacgctgttacaaattatcggctattaggaagt
atatttgatgtactgagtgcgattgaatgtgaattagaaacgggtcgtacgcatcaaatt
agagtgcatatgagtgagcatggacatcctattataggagatctcatatactcaaaggag
agatgtataaagcaccttattatgaaactacagaagtgcgcgaataaaagtgatatgagt
gatatgaatgctacagaaataatagatgagacgatcaatgaattaacaagagtaagaaga
cagcttttacactcaaaagcgatatctttcgtacatccgattactcatcaacacttgata
ataaaagcgcaactaagagacgatatgctaaaactagctacttgtacaatttcgccatcg
tatagcgaattttag

DBGET integrated database retrieval system