KEGG   Fibrobacter succinogenes: Fisuc_0510
Entry
Fisuc_0510        CDS       T01099                                 

Definition
(GenBank) Aspartoacylase
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
fsu  Fibrobacter succinogenes
Brite
KEGG Orthology (KO) [BR:fsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Fisuc_0510
Enzymes [BR:fsu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     Fisuc_0510
SSDB
Motif
Pfam: AstE_AspA
Other DBs
NCBI-ProteinID: ACX74122
UniProt: C9RLW0
Position
complement(585869..586771)
AA seq 300 aa
MINTIVIAGGTHGNERTGVSLVEKWKAHPECYNTLCKSATVDVVLANPEAVRLNRRYCDH
DLNRAFAQTCLDMSVEPAQYEFRRARELNKIYGPKGENTRTDLILDVHNTGSNMGYCLIL
STRDPFTMKASAVLTQEFEDAWIYYQPEERSASPYFGTVAKADVCIEIGPQQHGTLNAAI
FERSEKLVKRYLELAEEWNRGELQKRAPIKVEVYTQLRDLGYPKPQGGGAIQAMIHPELD
GHDYRELRQGDKLFRTFDGKDILFDGEPDGRSVYPIFINEPAYYEKDIAMSLTVKTVEEW
NT seq 903 nt   +upstreamnt  +downstreamnt
atgataaatacaatagtcattgctggtggaacgcatggcaacgaacgcacgggcgtgagt
ctggtcgaaaagtggaaggctcatcctgaatgttataacacgctttgtaaatcggcgacg
gttgatgtcgtgcttgcaaatccggaggcggttcgccttaatcgccgttactgcgaccat
gacttgaaccgcgcatttgctcagacttgcttggatatgtccgtggagcctgcgcagtac
gaattccgccgtgctcgtgaactcaataagatttatggacctaagggcgaaaatacgcgc
accgatctgattttggacgtacacaacacgggctcgaacatgggctattgcctgattctt
tcgactcgtgacccgtttacgatgaaggcttcggctgtgctcacgcaagaattcgaggat
gcctggatttattaccagcccgaagaacgtagcgcttcgccgtactttggaacggtcgcc
aaggcggacgtgtgcattgaaattggcccgcagcagcatggaacgctgaatgccgccatt
tttgaacgctccgaaaagcttgtgaaacgttatttggaactcgctgaggaatggaaccgt
ggcgagttgcaaaagcgcgccccgattaaggttgaagtttatacgcaattgcgcgacctg
ggctacccgaagccgcagggcggtggcgccatacaggcgatgattcacccggaattggat
ggtcacgattaccgcgaactcagacaaggcgacaagcttttccgcacgtttgatggcaag
gacatcttgttcgatggcgaaccggacggccgctcggtctacccgatatttatcaacgaa
cccgcgtactacgagaaagacattgccatgagcctcacggtgaaaactgtggaagaatgg
taa

DBGET integrated database retrieval system