KEGG   Fibrobacter succinogenes: Fisuc_0777Help
Entry
Fisuc_0777        CDS       T01099                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
fsu  Fibrobacter succinogenes
Pathway
fsu00521  Streptomycin biosynthesis
fsu00523  Polyketide sugar unit biosynthesis
fsu01130  Biosynthesis of antibiotics
Module
fsu_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:fsu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Fisuc_0777
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Fisuc_0777
Enzymes [BR:fsu01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Fisuc_0777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ACX74387
UniProt: C9RNE1
Position
complement(944078..944641)
Genome map
AA seq 187 aa AA seqDB search
MSKFNFINTEIEGVKIIEPTVFGDARGYFMETYSKRDFAEGGIDVDFVQDNESRSRKGVL
RGLHFQKQNPQGKLVRVIEGEVFDVAVDLRKNSKTFGKWVGVTLSAENKKQFYIPEGFAH
GFVVLSETAAFVYKCTRFYAPNDEGGLFWNDPAIGIKWPVGEGFEPLLSEKDTKNPLLKD
LDFAFDL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaattcaactttataaatacagaaatcgaaggtgttaagattattgaaccgacg
gtgtttggtgacgctcgcggttactttatggaaacttacagcaagcgcgactttgccgaa
ggcggcattgacgtagactttgttcaagataacgagtcccgttcgcgcaagggcgttctc
cgcggtctccacttccagaagcagaatccgcagggcaagcttgtccgcgtgattgaaggc
gaagtctttgacgtggccgtggacctccgcaagaacagcaagacttttggcaagtgggtg
ggtgttacgctctccgccgaaaacaagaaacagttctacatcccagaaggctttgcacac
ggtttcgtggtactttccgaaacggctgcatttgtctacaaatgcactcgcttctacgct
ccgaatgatgaaggcggccttttctggaacgacccggctatcggcatcaagtggccggtg
ggcgaaggttttgaaccgctcctctctgaaaaggataccaagaatcctcttctcaaggac
cttgatttcgcttttgacctttag

DBGET integrated database retrieval system