KEGG   Fibrobacter succinogenes: Fisuc_0921Help
Entry
Fisuc_0921        CDS       T01099                                 

Definition
(GenBank) Peroxiredoxin
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
fsu  Fibrobacter succinogenes
Pathway
fsu00480  Glutathione metabolism
fsu00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:fsu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Fisuc_0921
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Fisuc_0921
Enzymes [BR:fsu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Fisuc_0921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ACX74528
UniProt: C9RP64
Position
1152188..1152730
Genome map
AA seq 180 aa AA seqDB search
MTIYDFTLTDGKGNEIPLSKFKGQVMLIVNTATGCGFTPHYKPIEKMYTDFHDKGFEVID
IPCNQFMGQTPGTDDEIHEFCTLKYGTTFPQMKKSDVNGPNELPLYTYLKSKIGFEGFGF
GVKAAAMAMLLKKIDKDYKNNPDIKWNFTKFVIDRAGNVVARFEPTAKMEDVRSCVEKLL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgacaatctacgacttcacacttaccgatggtaaaggcaacgaaattccactctctaaa
ttcaagggccaagtcatgctcatcgtgaacacggcgaccggctgcggtttcaccccacat
tacaagccgatcgaaaagatgtacacagacttccacgacaagggcttcgaagtcatcgac
attccatgcaaccagttcatgggccagacccctggcacagacgacgaaattcatgaattc
tgcacgctcaagtacggcaccacgttcccgcagatgaaaaagtctgacgtgaacggaccc
aacgagctcccgctttacacctacctgaaatccaaaataggctttgaaggtttcggattc
ggcgtcaaggcggcagcaatggccatgcttctgaagaagatcgacaaggattacaagaat
aatcctgatatcaagtggaacttcacaaagttcgtcatcgaccgcgcaggcaacgttgtc
gcccgttttgaacccactgccaaaatggaggacgtacgttcttgcgttgaaaagctactt
tag

DBGET integrated database retrieval system