KEGG   Frankia symbiont: FsymDg_0955Help
Entry
FsymDg_0955       CDS       T01530                                 

Definition
(GenBank) Glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
fsy  Frankia symbiont
Pathway
fsy00860  Porphyrin and chlorophyll metabolism
fsy01100  Metabolic pathways
fsy01110  Biosynthesis of secondary metabolites
fsy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fsy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FsymDg_0955
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:fsy01007]
    FsymDg_0955
Enzymes [BR:fsy01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     FsymDg_0955
Amino acid related enzymes [BR:fsy01007]
 Aminotransferase (transaminase)
  Class III
   FsymDg_0955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AEH08460
UniProt: F8AXA7
Position
1118110..1119516
Genome map
AA seq 468 aa AA seqDB search
MAGTASEPKEGALSARRDERVAALTEREELRLQACTPGSRAMHARAVRSMTGGVPSSYQA
RDPWPIYLTHGRGSRVWDVDGSEYCDFHNGFGSMVQGHAHPAIVRAVRERIGLGSHFAMP
TEDSVIVSEELARRFGLPQWRYLNSGSEATMDAIRIARAITGRETIIKIFGSYHGHHDYV
MVSIGTPYDEIGPPDNMASFAYGEGIPRAVVDLTVPVPFNDAPTMERRIEALAADGRPPA
CVIMEAAMMNLGVILPEPGYLEAVREITRRHGIVLIFDEVKTGLCVAPGGATERFGVRPD
MVTLAKALGGGLPSGAVGATVEIMEVVASDRVKQVGTFNGNPLTMAAARASLLEVLTPQA
YAHLDRLCELLIAGCDEILRRHGLPGYTVGISSKGCVHFTDAPIRDYTSFMAHQNAALPE
LAWLYNANRGVLMAPGREEEWTLSVQHTEADVDRYLDSLDALARDVTS
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggccggaacagcgtccgaaccgaaggaaggcgccttgtcggcccgtcgcgacgagcgg
gtggccgccctgaccgagcgtgaggaactgcggctacaggcgtgcaccccgggctcacgg
gcgatgcacgcccgggcggtgcggtcgatgaccggtggggttccgtcgtcctaccaggcc
cgtgatccctggccgatctacctcacgcacgggcgcggttcccgggtatgggacgtcgac
ggcagcgagtactgcgacttccacaacggcttcgggtcgatggtgcaggggcacgcgcac
ccggcgatcgtccgggcggtgcgggagcggatcgggctgggcagccacttcgccatgccg
accgaggactccgtgatcgtcagtgaggagctggcccgtcgtttcggcctgccgcagtgg
cgctatctcaactcgggttcggaagcgacgatggacgcgatccggatcgcccgggccatc
accgggcgcgagacgatcatcaagatcttcggctcctaccacggccaccacgactacgtg
atggtctccatcggcaccccgtacgacgagatcggcccgcccgacaacatggcgtccttc
gcctatggtgaaggcataccgcgggccgttgtcgacctgaccgtaccggtgccgttcaac
gacgccccgaccatggaacggcggatcgaggcgctcgccgccgacgggcgaccaccggca
tgtgtgatcatggaagccgcgatgatgaacctcggggtgatcctgcccgagcccggctac
ctggaggccgtccgggagatcacccggcgccacggcatcgtgctgatcttcgacgaggtc
aagaccgggctgtgcgtggcgcccgggggagcgaccgagcggttcggcgtccggcccgac
atggtcacccttgccaaggcgctcggcggtggcctgccctccggcgccgtcggcgcgacc
gtcgagatcatggaggtggtggcgtcggaccgggtcaaacaggtcgggacgttcaacggc
aacccgctgaccatggccgcggcccgggcgagcctgctggaggtcctcaccccgcaggcc
tacgcccacctggaccggctgtgtgagctgctgatcgcaggctgcgacgagattcttcgc
aggcacgggctgcccggctacacggtcgggatcagctcgaagggctgcgtccacttcacc
gacgcgccgattcgcgactacacctccttcatggcgcaccagaacgcggcgctgccggag
ctcgcgtggctgtacaacgccaaccggggcgtgctgatggcgccgggccgggaggaggag
tggacactgtcggtgcagcacaccgaggccgacgtcgaccgctacctggactccctcgac
gcgctggcccgagacgtcacctcatga

DBGET integrated database retrieval system