KEGG   Frankia symbiont: FsymDg_2074Help
Entry
FsymDg_2074       CDS       T01530                                 

Definition
(GenBank) Betaine-aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
fsy  Frankia symbiont
Pathway
fsy00010  Glycolysis / Gluconeogenesis
fsy00053  Ascorbate and aldarate metabolism
fsy00071  Fatty acid degradation
fsy00280  Valine, leucine and isoleucine degradation
fsy00310  Lysine degradation
fsy00330  Arginine and proline metabolism
fsy00340  Histidine metabolism
fsy00380  Tryptophan metabolism
fsy00410  beta-Alanine metabolism
fsy00561  Glycerolipid metabolism
fsy00620  Pyruvate metabolism
fsy00625  Chloroalkane and chloroalkene degradation
fsy00903  Limonene and pinene degradation
fsy01100  Metabolic pathways
fsy01110  Biosynthesis of secondary metabolites
fsy01120  Microbial metabolism in diverse environments
fsy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FsymDg_2074
   00053 Ascorbate and aldarate metabolism
    FsymDg_2074
   00620 Pyruvate metabolism
    FsymDg_2074
  09103 Lipid metabolism
   00071 Fatty acid degradation
    FsymDg_2074
   00561 Glycerolipid metabolism
    FsymDg_2074
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FsymDg_2074
   00310 Lysine degradation
    FsymDg_2074
   00330 Arginine and proline metabolism
    FsymDg_2074
   00340 Histidine metabolism
    FsymDg_2074
   00380 Tryptophan metabolism
    FsymDg_2074
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FsymDg_2074
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    FsymDg_2074
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    FsymDg_2074
Enzymes [BR:fsy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     FsymDg_2074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AEH09497
UniProt: F8AY67
Position
2466020..2467531
Genome map
AA seq 503 aa AA seqDB search
MSVPHYGLFIDGEWVDSAEKYEIRSPATDELVATVAKGGTADVDRAVAAAKAAHEAGQWR
RTPPQERAAVLHAVADRLEKRLQELAALQTRENGATIRVTGALHLGLSIAQLRYIADLAT
TYEFEKNGPEIGPIPAVGVLRREPLGVVAAIVPWNIPLLVIVWKVGPALAAGNTVVLKPD
EHSPLVALELAKEFEAAGLPKGVLNLVTGDGDPVGAHLSGHPDVRKVAFTGSTEVGKSIL
SKSADTVKRVTLELGGKGPNVVLDDADVPLAVDGALFAALANNGQACEAGTRLLVPNSLK
EEFLTRLVERAKTLKLGNPLDLATDVGPVISSGQRDRILGYIESARADGATIALGGGVPQ
GPEFATGNWVEPTIVTDVTNDQRIAREEVFGPVLTVLTYDSVDEAIKIANDTNYGLSAGV
WGRDESRALDVARQLDAGMVYVNDWHVINPAYPFGGYKQSGLGREGGPNALDAYTEQKYI
AVDRSGGLENRAAFALVLGTPPA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgtaccgcattacgggttgttcatcgacggagaatgggtcgactccgccgagaag
tacgagattcgcagtcccgcgacggacgagctggtggcaacggtcgccaagggcgggacc
gccgacgtggaccgggcggttgccgccgccaaggccgcgcacgaggcggggcagtggcgg
cgtaccccgccgcaggagcgtgccgcggtgctgcacgcggtcgcggaccgcctggagaag
cggctgcaggagttggcggccctgcagacccgggagaacggcgcgacgatccgcgtcacc
ggggccctgcaccttggcctgtccatcgcccagctgcgttacatcgccgacctcgcgacg
acctacgagttcgagaagaacgggcccgagatcgggccgatcccggccgtgggtgtgctg
cgccgcgagccgctgggcgtggtggccgcgatcgtgccgtggaacatcccgctgctggtc
atcgtctggaaggtcggcccggcgctggccgcgggcaacaccgtcgtgctcaagcccgac
gagcactcgccgctggtcgcgctcgagctggccaaggagttcgaggccgccggtctgccc
aagggcgtgctgaacctcgtcaccggtgacggcgacccggtgggcgcccacctcagcggc
cacccggacgtccgcaaggtggccttcaccgggtcgaccgaggtgggcaagagcatcctg
agcaagtccgccgacacggtcaagcgggtcaccctcgagctcggcggcaaggggccgaac
gtcgtcctcgacgacgcggacgtgccactggccgtcgacggagcgctgttcgcggccctg
gccaacaacgggcaggcctgcgaggcgggaaccaggctgctggtgccgaacagcctgaag
gaggagttcctcaccaggctggtggagcgggcgaagaccctcaagctcggcaacccgctg
gacctcgccaccgacgtcggcccggtgatcagctccgggcagcgggaccgcatcctgggc
tacatcgagtccgcccgggcggacggcgccaccatcgcgctcggcggcggggtgccgcag
gggccggagttcgccaccgggaactgggtggagccgaccatcgtcacggacgtcaccaac
gaccagcgcatcgcccgggaagaggtcttcggcccggtgctgaccgtgctgacctacgac
tccgtggacgaggcgatcaagattgccaacgacacgaactacggcctgtcggccggggtg
tggggacgtgacgagtcccgggcgctggacgtggcccggcagctggacgccggcatggtc
tacgtcaacgactggcacgtgatcaacccggcctacccgttcggcggctacaagcagagc
ggcctggggcgcgagggtggcccgaacgcgctcgacgcctacaccgagcagaagtacatc
gcggtcgaccgcagcggcggactggagaaccgggcggcgttcgccctggtactggggacg
ccgcccgcataa

DBGET integrated database retrieval system