KEGG   Frankia symbiont: FsymDg_2637Help
Entry
FsymDg_2637       CDS       T01530                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
fsy  Frankia symbiont
Pathway
fsy00620  Pyruvate metabolism
fsy00630  Glyoxylate and dicarboxylate metabolism
fsy01100  Metabolic pathways
fsy01110  Biosynthesis of secondary metabolites
fsy01120  Microbial metabolism in diverse environments
fsy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    FsymDg_2637
   00630 Glyoxylate and dicarboxylate metabolism
    FsymDg_2637
Enzymes [BR:fsy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     FsymDg_2637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: AEH09993
UniProt: F8B3Y1
Position
3140911..3142536
Genome map
AA seq 541 aa AA seqDB search
MRVAEPGVPFPDVPAGVEITGPVGERFEEILTLPALALVADLERRFGPRRGELLTRRDEV
QAQLSAGANLDFLPHTRDVREGDWQVAPPPPGLLDRRVEITGPTDRKMTINALNSGAKVW
LADFEDANTPLWENMVTGQLNLRDALDRTIDFTSGDGRRYALADTLATIVARPRGWHLTE
KHLLVDGRPVSAGLFDFGLYFFHCAQRQLDAGGGPYFYLPKLESHLEARLWNDVFVHAED
ALGFPRGTIRATVLIETIPAAFEMEEILYELREHSAGLNAGRWDYLFSIIKKFRDRGERF
ALPDRNAVTMTAPFMRAYTDLLVRTCHRRGAHAIGGMAAFIPSRRDAEVNATALARVRAD
KTREAEAGFDGSWVAHPDLVALCREVFDGVLGERPNQLTRTREDVRVSAADLLDVASAPG
ERTLAGLRNNVSVALQYLRAWLRGTGAVAIFNLMEDAATAEIARSQVWQWLRGGVVLDDG
TPVTRELVERIVTEELATLRQTLGEGYDATGFEQARALFTELALADTFTDFLTLPAYDRL
P
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtggccgagcctggcgtcccgttccccgacgttcccgccggtgtggagatcact
ggccctgtcggggaacgcttcgaggagatcctgaccctcccggcgctggcgctggtcgcc
gatctggagcgccgcttcggcccacggcggggtgagctgctgacccggcgcgacgaggtg
caggcccagctgtccgccggcgcgaacctggacttcctcccccacaccagggacgtccgc
gagggcgactggcaggtcgccccgcccccgccgggccttctcgaccgccgggtcgagatc
accgggccgaccgaccgcaagatgacgatcaacgcgctgaactcgggcgcgaaggtctgg
ctggccgacttcgaggacgccaacacccccctgtgggagaacatggtcaccggccagctc
aacctgcgcgacgccctggaccgcaccatcgacttcaccagcggggacggccggcgctac
gccctcgccgacaccctggccacgatcgtggccaggccccgcggctggcacctgaccgag
aaacacctgctcgtcgacggccggcccgtctccgccggcctgttcgacttcgggctgtac
ttcttccactgcgcgcaacggcagctcgacgccggcgggggcccgtacttctacctcccg
aaactggaaagccatcttgaggcgcggctgtggaacgacgttttcgtccacgccgaggac
gccctcggttttccccggggcacgatccgcgccaccgtgctcatcgagacgatcccggcg
gccttcgaaatggaggagatcctctacgagctgcgtgagcattccgccgggctgaacgcg
ggccgctgggactacctgttcagcatcatcaagaagttccgcgaccggggtgagcggttc
gccctgcccgaccgcaacgcggtgacgatgaccgcccccttcatgcgcgcctacaccgac
ctgctggtgcgcacctgccaccggcgcggcgcccacgcgatcggcggcatggccgccttc
atccccagccgccgggacgccgaggtcaacgccaccgccctggccagggtgcgcgcggac
aagacccgcgaggccgaggccggcttcgacggatcctgggtcgcccaccccgacctggtg
gcgttgtgccgggaggtcttcgacggcgtgctcggcgagcgccccaaccagctcacccgc
acccgcgaggacgtgcgggtcagcgccgcggatctcctcgacgtcgcctccgcgcccggc
gagcggacactggcgggcctgcgcaacaacgtcagcgtcgccctccagtacctgcgcgcc
tggctgcggggcaccggcgccgtcgcaatcttcaacctgatggaggacgcggccaccgcc
gagatcgcccgctcccaggtgtggcagtggctgcgcggcggcgtcgtcctcgacgacggc
accccggtgacccgcgagctggtcgaacgcatcgtcaccgaggagctggccacgctccgc
cagaccctcggcgagggctacgacgcgaccggcttcgagcaggcccgcgccctgttcacc
gagctcgccctcgccgacaccttcaccgacttcctgaccctgcccgcctacgaccgcctg
ccgtaa

DBGET integrated database retrieval system