KEGG   Frankia symbiont: FsymDg_3020Help
Entry
FsymDg_3020       CDS       T01530                                 

Definition
(GenBank) Stearoyl-CoA 9-desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
fsy  Frankia symbiont
Pathway
fsy01040  Biosynthesis of unsaturated fatty acids
fsy01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    FsymDg_3020
Enzymes [BR:fsy01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     FsymDg_3020
Lipid biosynthesis proteins [BR:fsy01004]
 Desaturase
  First
   FsymDg_3020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-ProteinID: AEH10335
UniProt: F8AWV5
Position
3584230..3585234
Genome map
AA seq 334 aa AA seqDB search
MVGVRPATHVPESDFETVGSTPRKKTISSPYLHRLQRRHFLLFDVLPIAGTAAALAFLTV
HPIGVTELALLFSMWVVTGLGVTVGYHRLFTHRTFKAAPSVVAVLAVLGSMAGQGGVVSW
VALHRRHHECSDREGDPHSPNLAGGGLKGRLRGLAHSHFLWMRRHEYPNVVHYAPDLIRN
RALVRVARLYYYWVALGLALPALVGGLVYQSWAGAVSGLFWGGLVRMFVLEHIIWAINSF
LHMFGTHPYESRENSRNGGIFALLTFGESWHNNHHAFPDSSSFGLSWYRLDPGYWLIKIL
ALGGLAWDVKRPSEERMKASRISRNGKPAPSTTA
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggtcggcgtacggcccgcgacccatgttcccgagtccgatttcgagaccgtcggatcc
actcctcgcaagaagacgatcagtagtccttatctgcaccgcctgcagcgccgccatttt
ctgctgttcgacgtcctgccgattgccggtaccgccgccgccctcgcgtttctcacggtg
cacccgatcggtgtcaccgaactcgccctgctcttttccatgtgggtcgtgaccggcttg
ggcgtcaccgtcggttatcaccggctgttcacgcatcgcaccttcaaggccgcgccgtcc
gtcgtggccgtgctcgcggtcctcggctcgatggccggccagggcggtgtggtgtcctgg
gtcgccctgcaccggcgacaccacgagtgcagtgaccgtgagggagacccgcactccccg
aatctcgccggcggtggtctgaaaggccggctacgcggcctggcccactcccatttcctg
tggatgcgtcgtcacgagtacccgaacgtcgtccactacgcgcctgatctgatcaggaat
cgtgcgctggtccgggtcgcccgcctctactactactgggtcgcgctcgggctcgcgctc
cccgcgctcgtcggcggcctcgtctaccagagctgggccggggcggtcagcggcctcttc
tggggcggcctggtgcggatgttcgtcctggaacacatcatctgggcgatcaactccttc
ctgcacatgttcggcacccacccgtacgagtccagggagaacagcaggaacggcgggatc
tttgccctgctgacctttggcgagtcgtggcacaacaaccatcatgcctttcccgactcg
tcttctttcgggctgagctggtaccgtctcgacccgggctactggctcataaaaattctt
gctctcggtggtctcgcatgggacgtcaagcgcccgtccgaagagcggatgaaagcaagc
cgtatatccaggaacggcaagcccgcccccagtaccacggcataa

DBGET integrated database retrieval system