KEGG   Frankia symbiont: FsymDg_3312Help
Entry
FsymDg_3312       CDS       T01530                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
fsy  Frankia symbiont
Pathway
fsy00230  Purine metabolism
fsy01100  Metabolic pathways
Module
fsy_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:fsy00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    FsymDg_3312
Enzymes [BR:fsy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     FsymDg_3312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 AAA_22 AAA_33 RsgA_GTPase AAA_17 AAA_29
Motif
Other DBs
NCBI-ProteinID: AEH10616
UniProt: F8AZX1
Position
complement(3924342..3924887)
Genome map
AA seq 181 aa AA seqDB search
MRLTVLSGPSGVGKGTVVAEVRRRHPEVWVSVSCTTRAPRPGETNGVEYHFVDVEEFTLM
VKKGELLEHAMFAGHAYGTPRAPLEARLAEGVPCLLEIELQGARQVRAGIPDARFVFLAP
PSWQELVRRLTGRGTEPPEVIERRLDRARTELAAESEFDAVVVNDDVTRAAARLVALMDT
D
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgcggctcaccgttctgtccggtccgtcaggcgtcgggaaagggaccgtcgtcgccgag
gtgcgtcgacgccaccccgaggtctgggtttcggtcagttgcacgacacgcgcgccgcgc
ccgggggagaccaacggggtggagtatcacttcgttgatgtcgaggagttcaccctgatg
gtcaagaagggtgagcttcttgagcatgcgatgttcgccggtcatgcctatggaaccccc
cgcgcgccgctggaggcccgtctcgccgaaggggtgccgtgcctgctggaaatcgaactt
cagggcgcccggcaggtacgtgcgggtattcccgacgcccggttcgtcttcctcgccccg
ccgtcctggcaggagctggtccgtcggctcaccggacgcggcacggagccgccggaggtg
atcgaacgccgccttgaccgggcccgcaccgagcttgccgccgaatccgagttcgacgcg
gtggtggtcaacgacgacgtgacccgggcggcggcccggctggtagccctgatggacacc
gactag

DBGET integrated database retrieval system