KEGG   Frankia symbiont: FsymDg_3626Help
Entry
FsymDg_3626       CDS       T01530                                 

Definition
(GenBank) phosphoketolase
  KO
K01621  xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
fsy  Frankia symbiont
Pathway
fsy00030  Pentose phosphate pathway
fsy01100  Metabolic pathways
fsy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    FsymDg_3626
Enzymes [BR:fsy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     FsymDg_3626
    4.1.2.22  fructose-6-phosphate phosphoketolase
     FsymDg_3626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XFP_N XFP XFP_C TPP_enzyme_C Dimeth_Pyl
Motif
Other DBs
NCBI-ProteinID: AEH10905
UniProt: F8B3A4
Position
complement(4276263..4278659)
Genome map
AA seq 798 aa AA seqDB search
MPLSPGPLSPDELRRIHAYWRAANYLSVGQIYLLDNPLLRESLRAEHVKPRLLGHWGTTP
GLNLIYAHMNRVIRANDLNAIYVIGPGHGGPGIVANAYLEGTYSEVYPSITRDAAGLRRL
FRQFSFPGGIPSHVAPEIPGSIHEGGELGYALTHAFGAAFDNPDLLVCAVVGDGEAETGP
LAASWHSNKFLDPVRDGAVLPILHLNGYKIAQPTVLARIPQAELDQLMRGYGYQPFHVTG
DDPERVHQRFAAVMDTVVAEIARIQRQARAHGDPSRPPWPMIVLRTPKGWTGPSVVDGAQ
VEGTWRSHQVPVAQIHDNPEHLAELERWLHSYRPEELFDADGRLVAELTGLAPSGNRRMS
ANPHANGGELLRDLALPDFRDYAVEVANPATTFSEATRVLGGFLRDVMTANPTTFRVMGP
DETVSNRLGALFQTTSRAWNAQIVDGDDDLAPDGRVMEVLSEHLCQGWLEGYLLTGRHGF
FSCYEAFIHIVDSMVNQHAKWLKTTRHIPWRRPIASLNYLLTSHVWRQDHNGFSHQDPGF
IDHVVNKKAEIIRVYLPPDANTLLSVADHCLRSRHYINVIVAGKQPALNYLPMDAAIAHC
TRGIGIWDWASNDHGPASRSEHAAADGMPDVVMACAGDIPTLETLAAVDILRRHFPDLKV
RVVNIVDLMCLQPDSEHPHGISNARFDALFTADRPVIFAYHGYPWLIHRLTYRRTNHTNI
HVRGYIEEGTTTTPFDMVMMNNLDRFHLVIDVIDRVPSLGARAAHVWQDMVDARIAARTY
TRDFGTDMPEISNWTWPY
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgccgctgtcaccaggaccgctgtcaccggacgagctgcggcgcatccacgcctactgg
cgcgcggcgaactacctgtcggtcggtcagatctacctgctcgacaaccccctgctgcgg
gagtccctgcgggccgagcacgtcaagccccgtctgctcggccactggggcaccacaccg
ggactcaacctgatctacgcgcacatgaaccgcgtgatcagggcgaacgacctgaacgcg
atctacgtcatcggcccgggtcacggtggccccggcatcgtcgcgaacgcctacctggag
ggcacgtactccgaggtctatccctccatcacccgggacgccgccgggctgcgcaggctg
ttccgccagttctccttccccggcggcatccccagccacgtggcgccggagatccccggc
tcgatccacgagggcggggaactcggctacgccctcacccatgccttcggcgccgcgttc
gacaatcctgacctgctggtctgcgcggtcgtcggggacggggaggccgagaccggcccg
ctggcggcgagctggcactcgaacaagttcctcgatccggtccgtgacggcgcggtgctg
ccgatcctccacctgaacggctacaagatcgctcagccgaccgtgctcgcgcgcatcccg
caggccgagctcgaccagctgatgcgcggctacggctaccagccgttccacgttaccggg
gacgatcccgagcgggtccatcagcgcttcgccgccgtcatggacaccgtcgtcgccgag
atcgcccggattcagcggcaggcgcgagcgcacggcgacccgtcccgcccgccgtggccc
atgatcgtccttcgtaccccgaagggctggaccggcccgagcgtcgtcgacggcgcacag
gtcgagggcacgtggcgatcccatcaggtgccggtcgcgcagatccacgacaaccccgag
cacctggcggagctggagcggtggctgcacagctaccggcccgaggagctcttcgacgcc
gacggccgcctggtcgccgagctcaccggcctcgcgccgtcgggcaaccggcggatgagc
gcgaacccgcatgccaacggcggcgagctgctgcgtgacctcgccctgcccgacttccgt
gactacgccgtggaggtcgccaacccggccacgacgttcagtgaggcgacaagggtcctc
ggcggtttcctgcgggacgtgatgacggcgaacccgacgacgttccgggtcatgggcccg
gacgagaccgtctccaaccgtctcggcgcgctgttccagacgacgtcccgggcctggaac
gcgcagatcgtcgacggcgacgacgacctggcgccggacggccgggtcatggaggtgctc
tcggagcatctgtgccagggctggctggaggggtatctcctcaccggccggcacgggttc
ttctcctgctacgaggcgttcatccacatcgtcgactcgatggtgaaccagcacgcgaag
tggttgaagacgacccgccacatcccgtggcggcgtccgatcgcgtcgctgaactacctg
ctcaccagccatgtctggcggcaggaccacaacggcttctcccatcaggacccgggcttc
atcgaccatgtggtcaacaagaaggcggagataatccgggtgtacctcccgccggacgcg
aacacgttgctgtccgtcgccgaccactgcctgcgcagccggcactacatcaacgtcatc
gtggcgggcaagcagccggcgctgaactacctgccgatggacgcggcgatcgcccactgc
acccggggcatcggtatctgggactgggccagcaacgaccacggacccgccagccgctcc
gagcacgcagcagccgacggcatgcccgacgtggtcatggcctgcgccggcgacatcccg
accctggagaccctggccgcggtcgacatcctgcggcgccacttccctgacctgaaggtg
cgcgtcgtcaacatcgtcgatctgatgtgcctccagcctgacagcgagcacccacacggg
atctccaacgcccgtttcgacgcgctgttcaccgccgaccgaccggtgatcttcgcttac
catggctacccgtggctgatccacaggctgacctaccggcggaccaaccacaccaacatc
catgtccgcggctacatcgaggagggcacgaccaccacgccgttcgacatggtgatgatg
aacaacctcgaccggttccacctggtgatcgacgtgatcgaccgggtgccgtcgctgggt
gcgcgcgccgcacacgtctggcaggacatggtggacgcccggatcgcggcccgcacgtac
acccgcgacttcggcacggacatgcccgagatctccaactggacctggccctactag

DBGET integrated database retrieval system