KEGG   Frankia symbiont: FsymDg_3956Help
Entry
FsymDg_3956       CDS       T01530                                 

Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
fsy  Frankia symbiont
Pathway
fsy03010  Ribosome
Brite
KEGG Orthology (KO) [BR:fsy00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    FsymDg_3956
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:fsy03011]
    FsymDg_3956
Ribosome [BR:fsy03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    FsymDg_3956
  Bacteria
    FsymDg_3956
  Archaea
    FsymDg_3956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AEH11231
UniProt: F8AV21
Position
complement(4637967..4638389)
Genome map
AA seq 140 aa AA seqDB search
MADALVDGVTRSGLAGARASARYVRVSPTKARRVIDLVRGRSASEALDILRFAPQAASED
VYKVVASAVANAEHNHGLDPATLWVGEAFVDEGPTLKRIRPRAQGRAYRIRKRTSHITVV
VESRPPVAGTRGAKSTGRAR
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
gtggctgacgctcttgtcgacggggtgacccgctccgggctggcgggcgcccgcgcgtcg
gcccgttacgtccgggtgtcgccgacgaaggcccgccgggtcatcgacctggtgcgtggc
cgctcggccagcgaggccctcgacatcctccggttcgccccgcaggcggccagcgaggac
gtctacaaggtggtcgcgagcgcggtggccaacgccgagcacaaccacggcctcgacccg
gccacgctctgggtcggtgaggcctttgtcgacgagggcccgaccctcaagcgcatccgt
ccacgggcccagggccgtgcctaccggatccgcaagcggaccagccacatcacggttgtc
gtggagagccggccgccggtcgcgggaacccgcggcgcgaagagcacagggagggcccgg
tag

DBGET integrated database retrieval system