KEGG   Francisella tularensis subsp. holarctica FTNF002-00: FTA_0831Help
Entry
FTA_0831          CDS       T00584                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
fta  Francisella tularensis subsp. holarctica FTNF002-00
Pathway
fta00520  Amino sugar and nucleotide sugar metabolism
fta01100  Metabolic pathways
fta01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    FTA_0831 (nagA)
Enzymes [BR:fta01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     FTA_0831 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: ABU61307
Position
774098..775231
Genome map
AA seq 377 aa AA seqDB search
MQSYILKGGKIYSQNDFEAKDIVVKDNVISDIVDDAKPAAFNLPIIELSGDDYVIPGFID
IHIHGSKGADVMDGDVDALAVISKSLYTQGVTSYLATTMTAANEQILKAMRAIKDYNSQT
HLDSAKIVGVHLEGPFISPGKIGAQNPNYLQEADVTKMASWHNACDSLIKKITIAPEIKN
ANKVIEFCNSKNIISSIGHTSCTMAQALNAIEQGCTHATHLFNAMSPIEHRNPGAATALL
MSKKVLAELIVDGIHLHPDMVKFTYAIKGSDKIALITDAMSAQSASEGVFELGGQKVIVK
DGQARLENGVLAGSVLTMNKALENVLKFTNCSLYNAVKMTSTNQAKSLGFKKGQIKGGFD
AEFVILNKNYQVKQVIG
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagctatattctaaaaggtggcaaaatttatagccaaaatgattttgaagctaag
gatattgtagttaaagataatgttattagtgatatagttgatgatgctaagccagcagct
tttaatttacctattattgagctaagtggtgatgattatgtgatacctggttttatcgat
atccatatccatggttcaaaaggtgctgatgttatggatggagatgttgatgccttagct
gtaatctctaaatcactatatacacaaggagtaactagctatcttgcgaccacaatgaca
gcagcaaatgagcaaatactcaaagcaatgcgtgctatcaaagattataattctcaaacc
cacttggatagtgcaaaaattgttggtgttcatctagaggggccatttatatcaccaggt
aagattggtgcacaaaatcccaattaccttcaagaagcagatgttactaaaatggcaagt
tggcataatgcttgtgatagtttaatcaaaaaaatcactattgccccagagattaagaat
gctaataaagtaatcgagttttgtaattctaaaaatataattagttcaataggtcatact
agctgtacaatggctcaagctctaaatgcgatagagcagggttgtacacatgcgacacat
ctatttaatgcaatgagtccgattgaacatcgcaatcctggtgcggcaacagcgttatta
atgtcaaaaaaagttttagcagagctaatagttgatggtattcatctacatcctgatatg
gttaagtttacctatgcgataaaaggtagtgataaaatcgcactaatcactgatgcgatg
tctgctcaaagtgctagtgaaggtgtatttgaattaggtggtcagaaagtcatagttaaa
gatggtcaggcaaggttagagaatggtgtgcttgcaggaagtgtcttgacaatgaataag
gcactagagaatgttttgaaatttacaaattgtagtctctataatgctgtgaaaatgaca
agtacaaatcaagctaagtcattagggtttaaaaaaggtcaaatcaaaggaggctttgat
gctgagtttgtaattctcaataaaaattatcaagttaaacaagttattggttag

DBGET integrated database retrieval system