KEGG   Francisella tularensis subsp. holarctica FTNF002-00: FTA_2007Help
Entry
FTA_2007          CDS       T00584                                 

Definition
(GenBank) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
fta  Francisella tularensis subsp. holarctica FTNF002-00
Pathway
fta00220  Arginine biosynthesis
fta00250  Alanine, aspartate and glutamate metabolism
fta00471  D-Glutamine and D-glutamate metabolism
fta01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fta00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FTA_2007
   00220 Arginine biosynthesis
    FTA_2007
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    FTA_2007
Enzymes [BR:fta01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     FTA_2007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase Ank_4 Ank_2 Ank_3 Ank Ank_5 EF-hand_7
Motif
Other DBs
NCBI-ProteinID: ABU62482
Position
1825441..1826982
Genome map
AA seq 513 aa AA seqDB search
MKTIMIKTTSSSGEDYYKNIFSAICDKDGFMTKTDILDILVESGISNDDPRINKLIAKLN
KFCDIDKIDFDTFQEITFENIGLIEKAINKGFIIPNFKDFKKEIEAIYNETKKNETGRNA
NYIPQLARVDPNLFAVAFCSVDGQIITLGDYLQPYCVQSTAKTITYCIATEENGEDKVHQ
HVGREPSGITFNAIALNKYDLPHNPMINSGAIMMCSLIKPEWNIADRFEYITNVWQDLAG
GEPIGFDNAVYHSEKETADRNYALAHFMKEVGAFPEGTNIHTALDFYFQTCSIQVNAKKM
AKIMASIANGGVCPFTSKKIFSPTTIRNCLSMMYSCGMYDFSGEYAFSVGLPAKSGVSGA
LAIAIPNVGGFAIFSPRLDPNHNSVRGVEFSKRLIEKFSFHNYDHITHCDKINPVENRMV
VESNLTFELIWAASAGDLSEIKRAVALGVDINKGDYDKRTALHLAAAEGHEDIVKYLIRK
GADINAIDRWGKKPLDDAIMNNNISIIELLDRT
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaataatgattaaaactacatcttctagtggtgaagattactataaaaatatt
tttagcgctatctgtgacaaagatggctttatgacaaagacagatattcttgatatctta
gttgagtcaggtattagcaatgatgatcctcgcattaataaattaatcgccaaattaaat
aaattctgtgatattgataagattgattttgatacatttcaagaaattacttttgaaaat
ataggtcttatcgaaaaagctattaataaaggctttatcattcccaactttaaggatttc
aaaaaagaaattgaagccatatataacgaaactaaaaagaatgaaacaggcagaaacgca
aactatattcctcaactagcaagggttgaccctaatctttttgctgtggctttttgtagt
gttgatggtcaaataattaccttaggagattatctacaaccatactgtgtacaatcaact
gcaaaaactatcacatattgtatagctactgaagaaaatggcgaagataaagttcatcaa
catgttggcagagaaccaagtggtattacttttaatgctatagcattaaacaagtatgac
ctacctcataatccaatgataaactccggcgctatcatgatgtgctcactaataaaaccg
gagtggaatattgctgatagatttgaatatattactaacgtttggcaagatctagcaggt
ggcgaacctatcggctttgataacgctgtatatcactccgaaaaagagaccgcagataga
aattatgctctagctcattttatgaaagaagtaggtgcttttccagagggcacaaatatc
cacactgctctagatttctatttccaaacttgctctattcaagttaacgcaaaaaaaatg
gcaaaaattatggcttccatagctaatggcggagtatgcccttttactagtaaaaaaata
ttttcaccaacaacgattcggaattgcttatcaatgatgtactcgtgtgggatgtatgat
ttttcaggtgaatatgcgttctctgttggattacctgcaaaatcaggggtgtcaggagct
ctagctatagctattccaaatgttggtggttttgcaattttttctcctcgacttgaccct
aatcataactccgtaagaggtgttgaatttagtaaaaggctaatagagaagtttagtttc
cataactatgatcatataactcattgtgacaaaataaatcccgttgagaatagaatggtt
gtcgaatcaaatttaacatttgaactaatttgggcagcaagtgccggtgacttatcagag
attaaaagagccgttgccttaggtgttgatattaacaaaggtgattatgataaaagaaca
gctcttcacctagccgctgctgaaggtcatgaagatattgttaaataccttatccgcaaa
ggagcagatattaatgctatagacagatggggtaaaaagccattagatgatgctataatg
aataataatatttctataattgagctgttagacagaacttaa

DBGET integrated database retrieval system