KEGG   Francisella tularensis subsp. holarctica FTT_1: DA46_1489Help
Entry
DA46_1489         CDS       T03713                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
ftc  Francisella tularensis subsp. holarctica FTT_1
Pathway
ftc00860  Porphyrin and chlorophyll metabolism
ftc01100  Metabolic pathways
ftc01110  Biosynthesis of secondary metabolites
ftc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ftc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DA46_1489 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ftc01007]
    DA46_1489 (hemL)
Enzymes [BR:ftc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     DA46_1489 (hemL)
Amino acid related enzymes [BR:ftc01007]
 Aminotransferase (transaminase)
  Class III
   DA46_1489 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AJI50649
UniProt: A0A0B6DNN3
Position
1332757..1334052
Genome map
AA seq 431 aa AA seqDB search
MENKSNSQILFAEAQQYIPGGVNSPVRAFKSVGQEFPRFIKFAKGAYLYDVDWNKYIDYI
GSWGPMILGHCDDDVLEAIQCQVKNGLSYGAPCKQEVDLAKKIIELMPNIEQVRFVNSGT
EATISAIRLARAYTCRNKIIKFEGCYHGHADEFLVAAGSGALSLGQPNSPGVPEDVVKDT
LVASFNDMESIQALFEKYKDEIACIIVEPIAGNMNMIFPQDGFLAKLRAICDQNSSLLIF
DEVMTGFRVALGGAQSIYNVKPDLTTLGKVIGGGMPVGAFGGRKEIMQKVSPAGPVYQAG
TLSGNPIAMTAGIKTLEKISQPGFFDELGAKAQKLVDGLNEAAKAYDFNFHAKCLGGMFG
LFFCSDKIAVNTFVDLGKTNLKMFNQFFAYMLDNGVYLAPSAYEAGFISIAHSDEDIEKT
ICLAKKFFQEN
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggagaataaatcaaactctcaaattttatttgcagaagcacagcaatatataccaggt
ggagtaaactctccagttagggcatttaagagtgttggacaagaatttccaagatttata
aagtttgcaaaaggcgcttatctatatgatgttgattggaacaaatacatagactatatt
ggatcatggggaccgatgattttaggtcattgtgatgacgatgttttagaagcaatacaa
tgtcaggtcaaaaatggactaagctatggagcaccatgtaagcaagaggttgatctagct
aaaaaaataattgagctaatgccaaatattgagcaagtaagatttgtaaactcaggtact
gaagctactattagtgcaatcagattagcaagagcatatacatgtagaaataaaattatt
aaatttgaaggctgttatcatggtcatgctgatgagtttcttgttgcagctggttctggt
gcgttatctctaggacaaccaaactctcctggagtgccggaagatgttgtcaaagatact
ttagtagctagttttaatgatatggagtctattcaagcactttttgaaaaatataaagat
gaaattgcttgtattatcgttgagccaattgctggtaatatgaatatgattttcccacaa
gatggcttcttagccaaacttagagctatttgtgatcaaaatagtagtttattgatattt
gatgaagtgatgactggttttagagttgctttgggtggtgcgcaaagtatctataatgtt
aagccagatttgacaactttgggtaaagttattggtggtggtatgccagttggggctttt
ggcggacgtaaagagattatgcaaaaagtttctccagctggaccagtttaccaagcaggg
acactatctggaaatcctattgcgatgacagcaggtatcaaaactttagaaaaaatctca
caaccagggttctttgatgagcttggagctaaagcacaaaagctagtagatggtttaaat
gaggctgctaaagcctatgattttaattttcatgcaaaatgtctgggcggaatgtttggt
ttatttttctgtagtgacaaaattgcagtaaatacatttgtagatttaggcaaaacaaac
cttaagatgtttaatcaattctttgcatatatgcttgataatggtgtatatttagcgcca
tcagcttatgaagcaggttttatttcaatagctcatagtgatgaagatattgaaaaaacc
atttgtcttgctaaaaaattttttcaagagaattag

DBGET integrated database retrieval system