KEGG   Francisella tularensis subsp. holarctica FTT_1: DA46_493Help
Entry
DA46_493          CDS       T03713                                 

Gene name
dfrA
Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
ftc  Francisella tularensis subsp. holarctica FTT_1
Pathway
ftc00670  One carbon pool by folate
ftc00790  Folate biosynthesis
ftc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ftc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DA46_493 (dfrA)
   00670 One carbon pool by folate
    DA46_493 (dfrA)
Enzymes [BR:ftc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     DA46_493 (dfrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1 YoeB_toxin Imm26
Motif
Other DBs
NCBI-ProteinID: AJI50948
UniProt: A0A0B6DXT9
Position
441540..442040
Genome map
AA seq 166 aa AA seqDB search
MISLIVAYDKNFGIGKENTLAWKLSEDLKNFKKITENNYIVMGRKTFESIGRPLPNRKNI
ILTRNKDYKQDKCLIINSTQDILNFAESKPHYEIFIIGGAQIYKEFLKYADRLYITEVDA
EMTDLDAFFPQWDKSKYKRIGHKQFKKNDKNEFDFTFSIFEKNKNL
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgatctcactaatcgttgcttatgataaaaactttggtataggtaaagaaaatactcta
gcatggaaactatcagaagatcttaagaactttaaaaaaataacagaaaacaactatatt
gttatgggtagaaaaacctttgaatcgattggtcgcccactaccgaatcgtaaaaatatt
attttaactagaaacaaagattacaaacaagataaatgtttaataataaatagtactcag
gatattttaaattttgctgaatcaaaaccacactacgaaatatttataatcggtggtgca
cagatctataaagaatttctaaaatacgcagatagattgtatataaccgaagttgatgca
gaaatgactgatcttgatgctttctttccacaatgggataaatcaaaatataaacgtatt
ggtcacaaacaattcaaaaaaaatgataaaaatgagtttgactttacatttagcatcttt
gaaaaaaataaaaatttgtaa

DBGET integrated database retrieval system