KEGG   Francisella tularensis subsp. novicida F6168: AS84_203Help
Entry
AS84_203          CDS       T03873                                 

Definition
(GenBank) cytidyltransferase-like domain protein
  KO
K13522  bifunctional NMN adenylyltransferase/nudix hydrolase [EC:2.7.7.1 3.6.1.-]
Organism
ftd  Francisella tularensis subsp. novicida F6168
Pathway
ftd00760  Nicotinate and nicotinamide metabolism
ftd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ftd00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    AS84_203
Enzymes [BR:ftd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     AS84_203
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.-  
     AS84_203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: AJI45437
Structure
PDB: 

Position
complement(230830..231873)
Genome map
AA seq 347 aa AA seqDB search
MYDISVFIGRFQPFHKGHLHNIIIALQNSKKVIINIGSCFNAPNIKNPFSFEQRKQMIES
DLQVAGIDLDTVVIEPLADYFYQEQKWQDELRKNVYKHAKNNNSIAIVGHIKDSSSYYIR
SFPEWDYIGVDNYKNFNATEFRQKFYNGIISKQYMCSNDPKLGTYNFLTKFMDTQAYQDL
VAENNYVIEYKRLWQKAPFKPNFVTVDALVIVNDHILMVQRKAYPGKDLWALPGGFLECD
ETIAQAIIRELFEETNINLTHEQLAIAKRCEKVFDYPDRSVRGRTISHVGLFVFDQWLSL
PEINAADDAKDVKWISLGSNIKNICDRMLEDHYQIITILLEECGKKL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtatgatatttcagtttttataggaagatttcagccttttcataagggtcacttacat
aatataataatagcgctacaaaatagcaaaaaagttataattaatattggtagttgtttt
aatgcaccaaatataaaaaaccctttttcttttgagcaaagaaaacagatgatagagagt
gatttacaagtcgctggaattgatttagatactgtagtcatagagcctttggctgactat
ttttatcaagaacaaaagtggcaggatgaattacgtaaaaatgtctataagcatgctaaa
aataataatagtatcgctattgttgggcatattaaggatagttctagctattatataaga
agttttcctgaatgggattatataggagttgataattataaaaactttaatgccactgaa
tttaggcaaaagttttataacggtattatatcaaagcaatatatgtgtagtaatgaccct
aaattaggtacttataactttttgacaaagtttatggatacacaagcatatcaagactta
gttgcagaaaataattatgttattgagtataaaagattatggcagaaagctccatttaag
ccaaactttgtgacggttgatgctttagttatagtgaatgatcatattttgatggtacag
aggaaagcttaccctggcaaagatttatgggcactgcctgggggatttttagagtgtgat
gaaactatcgcacaagctataattcgagagttatttgaagaaacaaatatcaacctaact
catgagcaactcgctatagcaaaacgctgtgaaaaagtttttgattatcctgatcgttca
gtaagaggtagaacaattagccatgttgggttgtttgtttttgatcaatggctaagctta
ccagagattaatgctgccgatgatgcaaaggatgtcaaatggatatctttaggctcaaat
attaaaaatatctgtgatagaatgttagaagatcattatcaaattatcacgattttatta
gaggaatgtggtaagaaactataa

DBGET integrated database retrieval system