KEGG   Francisella tularensis subsp. novicida F6168: AS84_226Help
Entry
AS84_226          CDS       T03873                                 

Gene name
metG
Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ftd  Francisella tularensis subsp. novicida F6168
Pathway
ftd00450  Selenocompound metabolism
ftd00970  Aminoacyl-tRNA biosynthesis
ftd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ftd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    AS84_226 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AS84_226 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ftd01007]
    AS84_226 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ftd03016]
    AS84_226 (metG)
Enzymes [BR:ftd01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     AS84_226 (metG)
Amino acid related enzymes [BR:ftd01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   AS84_226 (metG)
Transfer RNA biogenesis [BR:ftd03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    AS84_226 (metG)
 Prokaryotic type
   Other AARSs
    AS84_226 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f Adenyl_transf Med25_VWA
Motif
Other DBs
NCBI-ProteinID: AJI45111
Position
248841..250862
Genome map
AA seq 673 aa AA seqDB search
MRKILVTNALPYANGDLHLGHMLGYIQSDIWVRFQKLQGNQCIFVCGSDTHGTPIMLKAK
SLGITPEELVTKYSNRHLQDFTDFEINFDNYHSTHNSLNKEIVEDIYNKLNNKNLISKKA
IAQAYDPEAKMFLPDRFVKGTCPKCKAEDQYGDSCEVCGATYDPTELINPRSVISGQSPI
QKNSEHFFFDLPALEKNIKDWIESNTLLQPEVANKLAEWFQQGLQSWDISRDAPYFGFAI
PGTNEQKFFYVWLDAPMGYIASFKDYCNRNEIDFDDFWGDNSESELYHFIGKDIIYFHAL
FWPAILSSTGYKTPTSVFANGFLTVNGKKMSKSRGTFIQARTYLDNLEPSYLRYYFASRL
TSRIDDIDLNLEEFVTKSNSDIVGKVVNIASRCAAFIYKKFDATLSGEIFDPELESEFSK
NHDAITQAFEKREFAHAVRLIMALADKANQFIDYHKPWQLAKEEGQEQKVHQVCSQGINM
FKVLIAYLKPIIPSIVAEAERFLNIQFISWADAPKFLTNHKIDKFKPLATRIEKEKVDKI
LEDTKKMLENEQAPQSKKEEPKLDIAAECTFDDFMKVDLRIAKITEASHVEGADKLLKLI
LDLGGVTKQVFAGIKSAYKPEDLIGKHTVMVANLAPRKMKFGMSEGMVLAAGDGKGIYIL
EPHEGAQPGMRVK
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaaaatactcgtcactaatgctctgccatatgctaatggcgacttacatttaggt
cacatgctcggctatatacaatccgacatctgggtcagattccaaaaactacaaggcaat
caatgcatatttgtctgtggtagtgatactcatggtacgccaataatgctcaaagccaag
agtcttggaattactccagaagagttagttacaaaatactctaatagacacttacaagat
tttactgattttgaaattaattttgacaattatcactctactcataattctctaaataaa
gagattgttgaagatatatataataaacttaacaataaaaatcttatttcaaaaaaagca
atagctcaagcttatgaccctgaggctaaaatgtttttgccagatagatttgtcaaggga
acttgtccaaaatgtaaagctgaagatcagtatggtgatagctgtgaagtttgtggtgcc
acatatgatcctacagagcttatcaatccaagatctgtaatatctggtcaatcgccaata
caaaaaaactctgaacatttcttttttgacttacctgcattagaaaaaaatataaaagat
tggatagaatctaataccctcttacaaccagaagttgctaacaaactagcagaatggttt
caacaaggtttgcaaagttgggatatctcgcgtgatgcgccatattttggctttgcaatc
ccaggtacaaatgaacaaaaattcttctatgtgtggctagatgctcctatgggctatatc
gcaagctttaaagactactgcaatagaaatgagattgattttgatgatttctggggagat
aatagtgaaagtgagctttatcattttattggtaaagatattatttattttcatgcacta
ttttggccagcaatattatcatctactggttataagacacctactagtgtatttgctaat
ggtttcttaactgtaaatggtaaaaagatgtcaaaatctcgagggacattcattcaagct
agaacttacctagataatttagagcctagttatttaagatactactttgcgtcaagattg
acatcccgtattgatgatatagatttgaatctagaggaatttgttactaaatcaaattct
gatatagtaggtaaggtagtcaatattgccagtcgttgtgctgcatttatatacaaaaaa
tttgatgctaccttgtctggagagatttttgatccagaattagaaagtgaatttagtaaa
aaccacgatgctataacacaagcttttgagaaaagagagtttgcccacgctgtgagactg
ataatggcattagccgataaagctaatcaatttatagattaccataaaccttggcaacta
gctaaagaagaaggacaagaacaaaaagttcatcaagtctgttcacaaggtataaatatg
tttaaggttttaatcgcttatcttaagcctattattcctagcattgttgctgaggcagag
agatttttaaatatacagttcataagctgggctgatgctccaaagtttttaacaaatcat
aaaatagataaattcaaacctctagccactcgtatcgaaaaagaaaaagtagacaaaatt
ttagaggatacaaagaaaatgttagaaaatgaacaagctccgcaatctaaaaaagaagag
cctaaactagatatcgcagctgaatgtacttttgatgattttatgaaagtagatttgcgt
atagctaaaattactgaagcttcacatgttgaaggtgcggataaattacttaaactaata
ttggatctaggtggtgtcaccaaacaagtttttgctggtatcaagtctgcttacaaacct
gaagatttaattggcaagcatactgtaatggtagcaaatctagctcctagaaaaatgaaa
tttggaatgtctgagggcatggttttagctgctggagatggtaaaggtatatatatactt
gagccacatgagggtgctcaaccaggtatgcgtgtcaaataa

DBGET integrated database retrieval system