KEGG   Fluviicola taffensis: Fluta_2495Help
Entry
Fluta_2495        CDS       T01455                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fte  Fluviicola taffensis
Pathway
fte00010  Glycolysis / Gluconeogenesis
fte00030  Pentose phosphate pathway
fte00051  Fructose and mannose metabolism
fte00052  Galactose metabolism
fte00680  Methane metabolism
fte01100  Metabolic pathways
fte01110  Biosynthesis of secondary metabolites
fte01120  Microbial metabolism in diverse environments
fte01130  Biosynthesis of antibiotics
fte01200  Carbon metabolism
fte01230  Biosynthesis of amino acids
fte03018  RNA degradation
Module
fte_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fte00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fluta_2495
   00030 Pentose phosphate pathway
    Fluta_2495
   00051 Fructose and mannose metabolism
    Fluta_2495
   00052 Galactose metabolism
    Fluta_2495
  Energy metabolism
   00680 Methane metabolism
    Fluta_2495
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Fluta_2495
Enzymes [BR:fte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Fluta_2495
Protein phosphatases and associated proteins [BR:fte01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Fluta_2495
Messenger RNA biogenesis [BR:fte03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Fluta_2495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AEA44480
UniProt: F2IDT8
Position
2874636..2875619
Genome map
AA seq 327 aa AA seqDB search
MSELKRIGVLTSGGDSPGMNACIRAVVKAGIGKGIQVFGIEDGYKGMIEDRIRELTYTDV
NNIIHLGGTILGTARSEEFKLKEWREKAVANLRKLQIEALILIGGDGTFAGGMTLTNEFD
IPIIGIPGTIDNDIHGTEFTIGYDTCLNTVVEAVDKIRDTASSHHRVFFIEVMGRASGYI
ALNTAIASGAESVLIPETVTDIPLLADQIRNQNKGIRSSIIIVAEGDEEGGAKEIMKKVK
PYLETYDLKCSILGHIQRGGSPSAFDRILATRMGVKAVELLFEGKKSMMIGQIGRDLVFH
NILEGTTDHVSKDDSGIGLLKLLLTKG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagctgaaaagaattggagttttgacttctggtggagattcaccaggaatgaat
gcgtgtattcgtgcagtggtgaaagctggaatcggaaaagggatacaggtatttgggatt
gaagatggatataaaggaatgattgaggatcgaattcgagaattaacctatacagacgtt
aataatatcattcatttgggaggtacaatcttaggaactgcaaggagtgaggaattcaaa
ttgaaggaatggcgagaaaaagcagttgctaatttaagaaaactccaaatcgaagcactt
atattaataggtggtgatggaacttttgctggaggaatgacattaacgaatgaattcgat
attcctattataggtattcctggtacaatagataatgatatccacggcacagaatttacg
ataggttatgatacttgtttgaatacagttgtagaggcggtggataaaattagagatact
gcttcaagccatcatcgagtgtttttcattgaagtaatgggaagagcttctggttatatc
gcattgaatacggcaattgctagtggagctgagtcagtactaattccagaaacagttacg
gacattcctttattggcagatcaaatccgaaatcaaaataaaggaatccgaagttctatt
attatagttgctgaaggcgatgaagagggaggtgcaaaagaaatcatgaaaaaggtaaag
ccttatcttgaaacttatgatttgaagtgttccattcttggacatatccaacgtggtggg
agtccatctgctttcgaccgaattcttgcaacaagaatgggggtaaaggcagttgaatta
ctttttgaaggaaaaaaatcaatgatgatcggtcaaattggaagagatttagtctttcac
aatatattagagggaacaacagatcacgtttcaaaagacgactcaggcattggattactc
aaattgttactgacaaaggggtag

DBGET integrated database retrieval system