KEGG   Fluviicola taffensis: Fluta_2511Help
Entry
Fluta_2511        CDS       T01455                                 

Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
fte  Fluviicola taffensis
Pathway
fte00790  Folate biosynthesis
fte01100  Metabolic pathways
Module
fte_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:fte00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Fluta_2511
Enzymes [BR:fte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Fluta_2511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK Flavodoxin_3
Motif
Other DBs
NCBI-ProteinID: AEA44496
UniProt: F2IDV4
Position
complement(2897453..2897989)
Genome map
AA seq 178 aa AA seqDB search
MARDKTTNYTDLIYIGVGTNLGDRLHNIQSAIEELKAMNIVVIRTASIYETEPWGFETSD
TFLNTVFECSSSMNAMDCLKALQFVEKKMGRKKKLKIGYESRVIDLDILLFKNQQINLIE
LTIPHPYLTDRQFVIIPMDELVNDTFFTSLSTNFTELKNRFKDLKTPFVVHYPPLVNE
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggcaagagataaaaccaccaactacactgatttaatttatatcggagttggaacaaat
ctgggagatcgtttacacaatattcaaagtgctattgaggaattaaaagcaatgaatatc
gttgttattcgaacagcttccatttatgaaacagaaccatggggatttgaaacatcagat
accttcttaaacaccgtgtttgaatgctccagctcaatgaatgcaatggattgtttaaaa
gcccttcaatttgtggaaaaaaaaatgggcagaaaaaagaaactcaaaatcgggtatgag
tcccgtgtaattgaccttgatatcttattgttcaaaaatcaacaaatcaaccttattgag
ttaactatcccacacccttatcttactgatagacagtttgtaatcatcccaatggatgaa
ttagttaacgacacttttttcacctctttgtccacaaattttacggaactaaaaaacaga
tttaaagacttgaaaacaccattcgtcgttcattatcctccacttgtcaatgaataa

DBGET integrated database retrieval system