KEGG   Francisella tularensis subsp. tularensis FSC198: FTF0817Help
Entry
FTF0817           CDS       T00381                                 

Gene name
thrS
Definition
(GenBank) Threonyl-tRNA synthetase
  KO
K01868  threonyl-tRNA synthetase [EC:6.1.1.3]
Organism
ftf  Francisella tularensis subsp. tularensis FSC198
Pathway
ftf00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ftf00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    FTF0817 (thrS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ftf01007]
    FTF0817 (thrS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ftf03016]
    FTF0817 (thrS)
Enzymes [BR:ftf01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.3  threonine---tRNA ligase
     FTF0817 (thrS)
Amino acid related enzymes [BR:ftf01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   FTF0817 (thrS)
Transfer RNA biogenesis [BR:ftf03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    FTF0817 (thrS)
 Prokaryotic type
    FTF0817 (thrS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b HGTP_anticodon tRNA_SAD TGS
Motif
Other DBs
NCBI-ProteinID: CAL08833
UniProt: Q14I20
Position
835053..836957
Genome map
AA seq 634 aa AA seqDB search
MINIRFPDGSIREFEAGVNSLDVAKSISPSLAKATMAAYIDDQLKDAKDAINSNCELRLI
TVKDPEGLEILRHSCAHLLAHAVKELYPNTEVTIGPVVDNGFYYDFSFKESIGEADLPTI
EKKMKELAKKSAPISYRVVPKAEAIEFFKAQGENYKVEIIDSIADEQMKIYTQDNFSDLC
RGPHIPNTSVLKAFKLTKLAGAYWRGNSDNEMLTRIYGTCWATKEDLEQYLNMLEEAEKR
DHRKIGKVLDLFHFQEDSPGIAFWHDNGVRIWRQVEDYMRASNNKYGCSEIRTPLIADFS
LWQKSGHASKYAENMFATKSENRDFAIRPMNCPTCVQVYNTKLHSYRDLPIRMAEFGIVH
RNEPSGSLHGLLRVRSFTQDDGHIFCTPEQVEEEVILMVQQCFEVYKDFGFNDFAVKIAL
RPENRIGDDETWDKSEQMLKNALDANNVSYELLPGEGAFYGPKIEFHLKDAIGRSWQCGT
IQLDFSMPQRLGATYIDKNGEKQVPVMLHRAIVGSLERFIGMLIEHYAGNLPLWLAPVQV
AVMGISNNQDDYCKEVFIMLEKNGIRAKLDLRNEKIGFKIREHTLLRVPYLVILGKNEQE
QKIITIRKHSGEDLGQMSVDDFCAFLDKQIQAKE
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgataaatatcagatttccagatggttcgataagagaatttgaagccggtgttaattct
ctagatgttgctaaatcaatatctccaagcttagctaaagctacaatggctgcgtatatt
gatgaccagctcaaagatgcaaaagatgcgattaacagtaactgtgaattaagattgata
acagtaaaagatccagagggtctcgaaattctaagacattcttgcgctcatcttttagct
catgctgtcaaagagttgtatccaaatactgaagtaactataggtccggtagttgataat
ggcttttattatgatttttctttcaaagagtctataggtgaagcagatttacctactatc
gaaaagaaaatgaaagaattagcaaaaaagtctgctcctattagttatagagtggttcct
aaagctgaagcaattgagttttttaaggctcaaggtgagaactataaggttgaaattatt
gatagcattgctgatgagcagatgaaaatatatacccaagataattttagtgacttgtgt
agaggtcctcatattccaaatacatcagtattaaaagcatttaagttgacaaaactagca
ggagcttattggcgaggtaactctgataatgaaatgctaactagaatctatggcacatgc
tgggcaactaaagaagatttagagcaatatttgaatatgcttgaagaggctgaaaagcgt
gatcatagaaaaattggtaaagttcttgatctatttcattttcaagaagactcaccaggc
atagctttttggcatgataatggtgtgagaatatggcgtcaagtagaagattatatgcga
gcttctaataataaatatggctgtagtgagattagaaccccacttattgcagattttagt
ttgtggcaaaaatctggtcacgcatctaagtatgctgagaatatgtttgcaacaaagtct
gagaacagggattttgctatcagaccaatgaactgtccaacttgtgtacaggtttataat
acaaagctacatagttatagagatctacctataaggatggctgagttcggtatagtacat
aggaatgaaccatctggatcgctacacgggttattaagagtacgtagctttactcaagat
gatgggcatattttctgtacccctgagcaggttgaagaagaagtgattttgatggtacag
cagtgttttgaagtatacaaagattttggttttaatgattttgcggtcaagattgcactt
agacctgaaaatagaattggagatgatgaaacttgggataaatctgaacagatgctcaaa
aatgctcttgacgctaataatgttagttatgaactacttccaggtgagggtgcattttat
ggtcctaagattgagtttcatctcaaagatgcaattggtagaagctggcagtgtggcact
atacaactagatttttcaatgccacaaaggctaggagctacatatattgacaagaatggc
gagaaacaggtgccagttatgcttcacagagctatcgttggttctttggagagatttata
ggtatgcttattgagcattatgctggaaatttaccattgtggttagctccagtccaagtt
gctgtgatgggaattagtaataatcaggatgactactgtaaagaagtatttataatgctt
gaaaaaaatggtatccgcgctaaattagacttgagaaatgagaaaatagggtttaaaata
cgtgagcatactcttttgcgtgtaccataccttgttatccttggtaaaaacgagcaagag
caaaagattatcacaataagaaagcatagcggcgaagatctaggacagatgtctgtagat
gatttttgtgcttttttagataagcaaatacaggctaaagaataa

DBGET integrated database retrieval system