KEGG   Francisella tularensis subsp. tularensis FSC198: FTF0932Help
Entry
FTF0932           CDS       T00381                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ftf  Francisella tularensis subsp. tularensis FSC198
Pathway
ftf00010  Glycolysis / Gluconeogenesis
ftf00052  Galactose metabolism
ftf00500  Starch and sucrose metabolism
ftf00520  Amino sugar and nucleotide sugar metabolism
ftf00521  Streptomycin biosynthesis
ftf01100  Metabolic pathways
ftf01110  Biosynthesis of secondary metabolites
ftf01120  Microbial metabolism in diverse environments
ftf01130  Biosynthesis of antibiotics
ftf01200  Carbon metabolism
Module
ftf_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ftf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FTF0932
   00052 Galactose metabolism
    FTF0932
   00500 Starch and sucrose metabolism
    FTF0932
   00520 Amino sugar and nucleotide sugar metabolism
    FTF0932
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    FTF0932
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    FTF0932
Enzymes [BR:ftf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     FTF0932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK IF2_N
Motif
Other DBs
NCBI-ProteinID: CAL08948
Position
944056..944907
Genome map
AA seq 283 aa AA seqDB search
MVGVDIGGTKVNAGRVCGENLLDSYLSKIPPDAEHNAQSVIDVVINTIAKVFTSEVEGIG
VGIPSVADREKGIVYDVQNIKSWQEIHLKEILEAEFKVPVFIDNDANCFAIGQRLYGKGK
QYENFVGITIGTGIGGGIINKGSLLKDSNCGAGEFGMLPYLDGILEDYCSGQFFIKKIGV
EDVEILKRARNNNKDAINIYKQFGKHLGVAIKSIMYTLDPEVIIIAGSIISAREFFEKAM
WDEIKTFAFTQSAKKIKIEWSETEGDFQVFGAAAVYLDRSSNL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtggttggtgttgatatcggtggcactaaagtgaatgctggtagggtatgtggagaaaat
ctattagactcttacttgagcaaaattccaccagatgcagaacataatgctcaatctgtt
attgatgttgtcataaatactatagcaaaagttttcacctctgaagtagaaggtattggc
gttgggattcctagtgttgcagatcgagaaaagggaattgtatatgatgtgcaaaatatc
aaatcatggcaagagattcatctaaaggaaatactagaggcagaatttaaagtaccagtt
tttatagataatgatgcaaactgttttgctattggacaaagactatatggtaaaggcaaa
caatatgaaaattttgttggtattacaataggtactggtattggtggaggaattataaat
aaaggctccttactaaaagactctaattgcggtgctggagaatttggcatgttgccatat
ctagatggaattttagaagattattgtagtggtcaattttttataaaaaagattggtgtt
gaagatgttgagattctcaagcgtgcaagaaataataataaagatgctataaatatctat
aaacaatttggtaaacatcttggagtagcaataaagtctattatgtatactctagaccca
gaagtgataataatcgcagggtcaataatatcagccagagagttttttgaaaaagcaatg
tgggatgagattaaaacatttgcctttactcaatcagctaaaaaaattaaaatagaatgg
tcagaaacggagggagattttcaggtttttggcgctgcagctgtttatttggatagaagt
agcaatttataa

DBGET integrated database retrieval system