KEGG   Francisella tularensis subsp. tularensis FSC198: FTF1349
Entry
FTF1349           CDS       T00381                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ftf  Francisella tularensis subsp. tularensis FSC198
SSDB
Motif
Pfam: DUF4280
Other DBs
NCBI-ProteinID: CAL09365
Position
1388124..1388645
AA seq 173 aa
MLNIINDSLKRLEEITTNDESISSSVSDLVADLNNIKILLAQSKLHLSSNASILTTSMGA
QIKCSYSLGSGIYLSTRIKTLTNNLPASNITDSKLGANILPFAGCTNPANPTMNPFSFPW
VCIPNLSAFIPTNPTTLLENAPITTINSKAMCMFAPGGIVDFISSGQINVKTS
NT seq 522 nt   +upstreamnt  +downstreamnt
atgttaaatattataaatgactccttaaaacgcttggaagaaataacgaccaatgatgaa
agtattagtagctcagtatctgatctagtggcggatttaaacaatataaaaattttatta
gctcaatcaaaactacacttatcaagcaatgcgtcaatattaaccacatcaatgggagca
caaattaaatgctcatatagtcttggatcaggaatttatcttagtacaagaataaaaaca
ctaacgaacaacttaccagcttcaaatattaccgattctaaactaggagctaacatttta
ccttttgctggatgtacaaatccagcaaaccctacaatgaacccatttagctttccttgg
gtatgtataccaaacttatctgcttttatccccacgaaccctactacgctactggaaaat
gctcctataactacaataaatagtaaagcaatgtgtatgtttgctccgggtggtatagtt
gattttattagtagtggacaaataaatgtaaaaacatcttag

DBGET integrated database retrieval system