KEGG   Francisella tularensis subsp. tularensis FSC198: FTF1707
Entry
FTF1707           CDS       T00381                                 

Definition
(GenBank) conserved hypothetical protein
Organism
ftf  Francisella tularensis subsp. tularensis FSC198
SSDB
Other DBs
NCBI-ProteinID: CAL09723
Position
1784081..1785232
AA seq 383 aa
MSQIISTLNNIDLVTQDKVNLISNMQIQAKYENAEYKSFIDQLIDNLNTTRSIDIYNLFL
SLNSEICLNLDTVDNISKIISSYLSILNTNFTRISPSESKQKNQLAEKGINKFLVTMDAN
FAQMQNQDKLLPNNIDSIIEIVQEVIIFFEKNNLNYNSDFKIQLNKTLRKIKSSLILKDQ
KNDTYSDKESINQVEATITDQKTIQGSEKWKTLIEKIEVLKALVESERIFETSIVYNDIQ
NLLVNFDPKEYFPEIFFPLYKKIAPFIGNIHKNIDYYSSSIQWSIAQKMYNIDYKSFLDT
LEKMPENNFLNSSSDITKNFFYETSSEVEKTPIEEHKIIADTDAIKEEIVIKQRTNNKKN
QNDPVEKISNKIDEDYFEDLFDI
NT seq 1152 nt   +upstreamnt  +downstreamnt
atgagtcagataatatctacactaaataatattgatttagtaactcaagataaagtaaat
ctgattagtaatatgcaaatacaagcaaaatatgaaaacgctgagtataagtcatttatt
gatcaattaatagataatcttaatactactagaagcatagatatatataacttatttcta
tctttaaattcagaaatatgcctcaatttagatacggttgataatatctctaaaattatt
agctcttatttatctattctaaatactaatttcacaagaattagtccatcagaatcaaag
caaaaaaaccagctagctgaaaaaggaataaacaaattcttagtcactatggatgcaaat
tttgcgcaaatgcagaatcaagacaagttgttaccaaataacatagattctattatagaa
attgtacaggaagtaataatattttttgagaaaaataacttaaattataattctgatttt
aaaatccaactaaataagactctcagaaaaataaaaagttctttgattttaaaagatcaa
aaaaatgatacgtattccgataaagaatcaataaatcaagttgaagcaactatcacagat
caaaaaaccatacaaggctctgagaaatggaaaactcttattgaaaaaattgaagtttta
aaagctctagttgaaagtgaaagaatatttgaaacatctattgtttataatgatatacaa
aacttattagttaacttcgatcctaaagagtattttccagaaattttctttccattatac
aagaagatagctccttttattggcaatatccataaaaacatagactactactcatcaagt
attcagtggagtatagctcagaagatgtacaacatagattataagagttttttagatact
cttgagaaaatgcccgaaaataattttttaaattcttcttctgatataactaaaaatttc
ttttatgaaacatcctcagaggtggaaaaaactcctatcgaagaacataaaataattgca
gatacagatgctatcaaagaagaaatagtaataaaacagcgaaccaataataaaaaaaac
cagaatgaccccgtagaaaaaatttcaaataaaatagatgaagactattttgaagatctt
tttgacatataa

DBGET integrated database retrieval system