KEGG   Francisella tularensis subsp. tularensis TIGB03: FTU_0309Help
Entry
FTU_0309          CDS       T01762                                 

Gene name
rplV1
Definition
(GenBank) LSU ribosomal protein L22p (L17e)
  KO
K02890  large subunit ribosomal protein L22
Organism
ftg  Francisella tularensis subsp. tularensis TIGB03
Pathway
ftg03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ftg00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    FTU_0309 (rplV1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ftg03011]
    FTU_0309 (rplV1)
Ribosome [BR:ftg03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    FTU_0309 (rplV1)
  Bacteria
    FTU_0309 (rplV1)
  Archaea
    FTU_0309 (rplV1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AFB78429
Position
340356..340691
Genome map
AA seq 111 aa AA seqDB search
MEVQAKLKFARISAQKCRLVADQIRGLPVEQAINLLTFSNKKAAVLIKGVLNSAVANAEH
NDGMDVDSLVVSTIFVDEGPTMKRFEARAKGRGNRILKRTSHITVKVAEKK
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggaagtacaagctaaattaaaatttgcaagaatctcagcgcagaagtgtagattagtt
gctgatcagatcaggggtctgccagtagagcaagctattaatcttttgacatttagtaat
aagaaagctgctgtattaattaagggagttttgaactctgcagtagctaacgctgaacac
aatgatggtatggatgttgactctttagtagtgtcgactatcttcgttgatgaaggtcct
acaatgaagcgttttgaagctagagcaaaaggtcgtggtaatcgtattctaaaaagaact
tcacatataactgtgaaagttgctgagaaaaaataa

DBGET integrated database retrieval system